Property Summary

NCBI Gene PubMed Count 5
Grant Count 117
R01 Count 46
Funding $25,574,969.36
PubMed Score 173.96
PubTator Score 9.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q8IYT2 B2RCD5 D3DWS1 Q8NE77 Q8NFR5 Q9H8Z4 Q9NUS3 Q9NXF5
Symbols AFT
MTr2
HMTr2
FTSJD1

Gene

Gene RIF (2)

PMID Text
24402442 Crystal structures of the active CMTr2 catalytic domain in complex with a methyl group donor and a capped oligoribonucleotide are examined, thereby revealing the mechanism of specific recognition of capped RNA.
21310715 A report on the validation of a human enzyme that methylates the ribose of the second transcribed nucleotide encoded by FTSJD1.

AA Sequence

MSKCRKTPVQQLASPASFSPDILADIFELFAKNFSYGKPLNNEWQLPDPSEIFTCDHTELNAFLDLKNSL      1 - 70
NEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCTQAWCKFHEILCSFPLIPQEAFQNGKLNS     71 - 140
LHLCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEANDDLMMIMDDRLIANTLHWWYFGPDNTGDI    141 - 210
MTLKFLTGLQNFISSMATVHLVTADGSFDCQGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMF    211 - 280
EHCSINLMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLNFGTEMKRKALFPHH    281 - 350
VIPDSFLKRHEECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAIQYFMQKFQLKHLSRNNWLV    351 - 420
KKSSIGCSTNTKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLE    421 - 490
CHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCHVFSEELIFSELC    491 - 560
SLTECLQDEQVVVPSNQIKCLLVGFSTLRNIKMHIPLEVRLLESAELTTFSCSLLHDGDPTYQRLFLDCL    561 - 630
LHSLRELHTGDVMILPVLSCFTRFMAGLIFVLHSCFRFITFVCPTSSDPLRTCAVLLCVGYQDLPNPVFR    631 - 700
YLQSVNELLSTLLNSDSPQQVLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHFIIQREREEIINSLQLQN    701 - 770
//

Text Mined References (7)

PMID Year Title
24402442 2014 Structural analysis of human 2'-O-ribose methyltransferases involved in mRNA cap structure formation.
21310715 2011 2'-O-ribose methylation of cap2 in human: function and evolution in a horizontally mobile family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.