Property Summary

NCBI Gene PubMed Count 5
PubMed Score 185.02
PubTator Score 9.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.600 3.8e-03
Astrocytoma, Pilocytic 1.500 5.8e-05
atypical teratoid / rhabdoid tumor 1.600 1.8e-04
Breast cancer 2.600 4.5e-02
ependymoma 1.300 2.9e-04
glioblastoma 1.700 6.5e-08
group 4 medulloblastoma 2.100 2.9e-05
hepatocellular carcinoma 1.400 1.3e-04
intraductal papillary-mucinous neoplasm ... 1.500 2.2e-02
juvenile dermatomyositis 1.014 2.5e-06
ovarian cancer -2.200 4.7e-06
primitive neuroectodermal tumor 1.500 6.3e-07

Gene RIF (2)

AA Sequence

MSKCRKTPVQQLASPASFSPDILADIFELFAKNFSYGKPLNNEWQLPDPSEIFTCDHTELNAFLDLKNSL      1 - 70
NEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCTQAWCKFHEILCSFPLIPQEAFQNGKLNS     71 - 140
LHLCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEANDDLMMIMDDRLIANTLHWWYFGPDNTGDI    141 - 210
MTLKFLTGLQNFISSMATVHLVTADGSFDCQGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMF    211 - 280
EHCSINLMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLNFGTEMKRKALFPHH    281 - 350
VIPDSFLKRHEECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAIQYFMQKFQLKHLSRNNWLV    351 - 420
KKSSIGCSTNTKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSSILEGTASNLE    421 - 490
CHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPKQQYSCSCHVFSEELIFSELC    491 - 560
SLTECLQDEQVVVPSNQIKCLLVGFSTLRNIKMHIPLEVRLLESAELTTFSCSLLHDGDPTYQRLFLDCL    561 - 630
LHSLRELHTGDVMILPVLSCFTRFMAGLIFVLHSCFRFITFVCPTSSDPLRTCAVLLCVGYQDLPNPVFR    631 - 700
YLQSVNELLSTLLNSDSPQQVLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHFIIQREREEIINSLQLQN    701 - 770
//

Text Mined References (7)

PMID Year Title