Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IYS8 B3KXU4 Q8WW13
Symbols BOD1P
FAM44C

Gene

AA Sequence

MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCKADVDTKPAYQ      1 - 70
NLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQII     71 - 140
HEFLVAQKEAAVPALPPEPEGQDPPAPSQDTS                                          141 - 172
//

Text Mined References (5)

PMID Year Title
17938248 2007 Bod1, a novel kinetochore protein required for chromosome biorientation.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.