Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCKADVDTKPAYQ      1 - 70
NLSQKADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQII     71 - 140
HEFLVAQKEAAVPALPPEPEGQDPPAPSQDTS                                          141 - 172
//

Text Mined References (5)

PMID Year Title