Property Summary

NCBI Gene PubMed Count 26
PubMed Score 0.00
PubTator Score 11.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.500 3.8e-08
non-small cell lung cancer -1.931 5.8e-24
osteosarcoma -3.355 1.3e-05
tuberculosis 1.500 3.0e-05

Gene RIF (19)

AA Sequence

MALVLILQLLTLWPLCHTDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEI      1 - 70
APLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVV     71 - 140
GPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRS    141 - 210
EVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDP    211 - 280
GV                                                                        281 - 282
//

Text Mined References (28)

PMID Year Title