Property Summary

NCBI Gene PubMed Count 26
PubMed Score 0.00
PubTator Score 11.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -3.355 0.000
tuberculosis 1.500 0.000
non-small cell lung cancer -1.931 0.000
lung adenocarcinoma -1.500 0.000

Gene RIF (19)

PMID Text
26786702 OSCAR can play a proinflammatory role in monocyte-derived cells and may contribute crucially on multiple levels to rheumatoid arthritis pathogenesis.
26552697 Each domain of OSCAR binds a collagen triple-helical peptide; the primary site is on the C-terminal domain in contrast to GPVI and LAIR-1.
25716998 OSCAR is a receptor for surfactant protein D that activates TNF-alpha release from human CCR2+ inflammatory monocytes.
24448348 Plasma OSCAR level was higher in the serum of RA patients than controls, and higher in patients with destructive RA rather than non-destructive RA.
23146195 Data indicate that osteoclast associated receptor (OSCAR) was strongly expressed by the vasculature of active rheumatoid arthritis (RA) patients.
22985931 endothelial cell-derived OSCAR was found to be involved in the STAT signaling pathway and to affect monocyte adhesion.
22949349 Rotative stress in mouse cells results in increased levels of Oscar transcription.
22009730 OSCAR is expressed in vascular endothelial cells and is regulated by oxLDL involving NFATc1
21841309 Data suggest that OSCAR is a collagen receptor that binds to specific collagen motifs and costimulates osteoclastogenesis in DAP12-deficient humans and mice.
21172874 This review discusses the structure-function relationship, expression pattern, and physiological role of OSCAR in osteoimmunology and summarizes its potential implications for human diseases.
More...

AA Sequence

MALVLILQLLTLWPLCHTDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEI      1 - 70
APLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVV     71 - 140
GPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRS    141 - 210
EVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDP    211 - 280
GV                                                                        281 - 282
//

Text Mined References (28)

PMID Year Title
26786702 2016 OSCAR-collagen signaling in monocytes plays a proinflammatory role and may contribute to the pathogenesis of rheumatoid arthritis.
26552697 2016 Structural basis for collagen recognition by the immune receptor OSCAR.
25716998 2015 OSCAR is a receptor for surfactant protein D that activates TNF-? release from human CCR2+ inflammatory monocytes.
24448348 2014 Levels of soluble osteoclast-associated receptor (sOSCAR) in rheumatoid arthritis: link to disease severity and cardiovascular risk.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23146195 2012 The immunoreceptor tyrosine-based activation motif (ITAM) -related factors are increased in synovial tissue and vasculature of rheumatoid arthritic joints.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
22985931 2012 Quantitative proteomics reveals novel functions of osteoclast-associated receptor in STAT signaling and cell adhesion in human endothelial cells.
22949349 2013 The effect of rotative stress on CAII, FAS, FASL, OSCAR, and TRAP gene expression in osteoclasts.
More...