Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.89
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IYS1 B4DYJ2 Q5T7J9 Q6MZV2 Q86XD9
Symbols ACY1L2
bA63L7.3

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
24891507 PM20D2 hydrolyzed beta-alanyl-lysine, beta-alanyl-ornithine, gamma-aminobutyryl-lysine, and gamma-aminobutyryl-ornithine as its best substrates.

AA Sequence

MRPGGERPVEGGACNGRSELELLKLRSAECIDEAAERLGALSRAIWSQPELAYEEHHAHRVLTHFFEREP      1 - 70
PAASWAVQPHYQLPTAFRAEWEPPEARAPSATPRPLHLGFLCEYDALPGIGHACGHNLIAEVGAAAALGV     71 - 140
RGALEGLPRPPPPVKVVVLGTPAEEDGGGKIDLIEAGAFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKY    141 - 210
YGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWRVHGIIKNGGVKPNIIPSYSELIYYFRAPSM    211 - 280
KELQVLTKKAEDCFRAAALASGCTVEIKGGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDTMLNGPSG    281 - 350
STDFGNVSFVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIRE    351 - 420
DFKLKLQEEQFVNAVE                                                          421 - 436
//

Text Mined References (9)

PMID Year Title
24891507 2014 Metabolite proofreading in carnosine and homocarnosine synthesis: molecular identification of PM20D2 as ?-alanyl-lysine dipeptidase.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.