Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.67
PubTator Score 6.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
20583170 Observational study of gene-disease association. (HuGE Navigator)
14563676 In Xenopus, TMEFF1 blocks nodal signaling through binding to the nodal coreceptor Cripto; it does not associate with either nodal or the type I activin receptor-like kinase (ALK) 4 receptor.
12743596 This protein may behave as a tumor suppressor gene in brain cancers.

AA Sequence

MGAAAAEAPLRLPAAPPLAFCCYTSVLLLFAFSLPGSRASNQPPGGGGGSGGDCPGGKGKSINCSELNVR      1 - 70
ESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKEITVIAR     71 - 140
GPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCASDGSSY    141 - 210
NNPCFVREASCIKQEQIDIRHLGHCTDTDDTSLLGKKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLN    211 - 280
GYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMC    281 - 350
ITRKCPKNNRGRRQKQNLGHFTSDTSSRMV                                            351 - 380
//

Text Mined References (10)

PMID Year Title
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16407223 2006 Protein interaction analysis of ST14 domains and their point and deletion mutants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14563676 2003 Tomoregulin-1 (TMEFF1) inhibits nodal signaling through direct binding to the nodal coreceptor Cripto.
12743596 2003 TMEFF1 and brain tumors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9730596 1998 Assignment1 of H7365 (C9orf2) to human chromosome band 9q31 by somatic cell hybrid analysis and fluorescence in situ hybridization.
8752111 1996 A novel transmembrane protein with epidermal growth factor and follistatin domains expressed in the hypothalamo-hypophysial axis of Xenopus laevis.