Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 42.37

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.300 5.7e-03
interstitial cystitis -1.300 2.5e-03
lung carcinoma 2.100 2.6e-31
non-small cell lung cancer 1.344 1.8e-14
osteosarcoma -1.045 1.2e-03
pancreatic ductal adenocarcinoma liver m... -1.260 2.5e-03

Gene RIF (1)

AA Sequence

MLHFNRCHHLKKITQKCFSSIHVKTDKHAQRFLSRTFALAELRKSWYSTHSLVGDKNIILMGPPGAGKTT      1 - 70
VGRIIGQKLGCCVIDVDDDILEKTWNMSVSEKLQDVGNEQFLEEEGKAVLNFSASGSVISLTGSNPMHDA     71 - 140
SMWHLKKNGIIVYLDVPLLDLICRLKLMKTDRIVGQNSGTSMKDLLKFRRQYYKKWYDARVFCESGASPE    141 - 210
EVADKVLNAIKRYQDVDSETFISTRHVWPEDCEQKVSAKFFSEAVIEGLASDGGLFVPAKEFPKLSCGEW    211 - 280
KSLVGATYVERAQILLERCIHPADIPAARLGEMIETAYGENFACSKIAPVRHLSGNQFILELFHGPTGSF    281 - 350
KDLSLQLMPHIFAHCIPPSCNYMILVATSGDTGSAVLNGFSRLNKNDKQRIAVVAFFPENGVSDFQKAQI    351 - 420
IGSQRENGWAVGVESDFDFCQTAIKRIFNDSDFTGFLTVEYGTILSSANSINWGRLLPQVVYHASAYLDL    421 - 490
VSQGFISFGSPVDVCIPTGNFGNILAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYDLRERKLAQTF    491 - 560
SPSIDILKSSNLERHLHLMANKDGQLMTELFNRLESQHHFQIEKALVEKLQQDFVADWCSEGECLAAINS    561 - 630
TYNTSGYILDPHTAVAKVVADRVQDKTCPVIISSTAHYSKFAPAIMQALKIKEINETSSSQLYLLGSYNA    631 - 700
LPPLHEALLERTKQQEKMEYQVCAADMNVLKSHVEQLVQNQFI                               701 - 743
//

Text Mined References (9)

PMID Year Title