Property Summary

NCBI Gene PubMed Count 9
PubMed Score 74.37
PubTator Score 26.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ulcerative colitis 2087 1.32724707600979E-6
osteosarcoma 7933 4.71701458828119E-6
pilocytic astrocytoma 3086 1.09044778642575E-5
medulloblastoma 1524 1.86850184329083E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.51988528725332E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.65404358933573E-5
atypical teratoid / rhabdoid tumor 4369 4.35879856545106E-5
primitive neuroectodermal tumor 3031 3.77674113086773E-4
Pick disease 1893 8.19606561421409E-4
astrocytic glioma 2241 0.00110306891232686
adrenocortical carcinoma 1427 0.00139372226712059
oligodendroglioma 2849 0.00155007965168126
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0015884399065195
medulloblastoma, large-cell 6234 0.00176193178569939
ependymoma 2514 0.00625163090105609
glioblastoma 5572 0.00886911977514268
pediatric high grade glioma 2712 0.019001967410729
fibroadenoma 557 0.0220001071041098
spina bifida 1064 0.027932085873544
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.983 2.0

Expression

  Differential Expression (19)

Synonym

Accession Q8IYP9 D3DN76
Symbols NIDD
DHHC-23

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Pathway (1)

AA Sequence

MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIM      1 - 70
DTISDRLRIPWLRGAKKVNISIIPPLVLLPVFLHVASWHFLLGVVVLTSLPVLALWYYYLTHRRKEQTLF     71 - 140
FLSLGLFSLGYMYYVFLQEVVPKGRVGPVQLAVLTCGLFLILLALHRAKKNPGYLSNPASGDRSLSSSQL    141 - 210
ECLSRKGQEKTKGFPGADMSGSLNNRTTKDDPKGSSKMPAGSPTKAKEDWCAKCQLVRPARAWHCRICGI    211 - 280
CVRRMDHHCVWINSCVGESNHQAFILALLIFLLTSVYGITLTLDTICRDRSVFTALFYCPGVYANYSSAL    281 - 350
SFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGLLG               351 - 409
//

Text Mined References (10)

PMID Year Title
22482804 2012 Combined analysis of genome-wide association studies for Crohn disease and psoriasis identifies seven shared susceptibility loci.
22399288 2012 Distinct acyl protein transferases and thioesterases control surface expression of calcium-activated potassium channels.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15105416 2004 NIDD, a novel DHHC-containing protein, targets neuronal nitric-oxide synthase (nNOS) to the synaptic membrane through a PDZ-dependent interaction and regulates nNOS activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.