Property Summary

NCBI Gene PubMed Count 9
PubMed Score 75.21
PubTator Score 26.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -1.023 2.4e-02
adrenocortical carcinoma 1.131 1.4e-03
astrocytic glioma -2.700 1.1e-03
Astrocytoma, Pilocytic -2.300 1.6e-05
atypical teratoid / rhabdoid tumor -2.600 4.4e-05
ependymoma -2.300 6.3e-03
fibroadenoma 1.100 2.2e-02
glioblastoma -2.000 8.9e-03
group 4 medulloblastoma -1.600 2.5e-02
intraductal papillary-mucinous adenoma (... 2.300 2.5e-05
intraductal papillary-mucinous carcinoma... 2.300 2.7e-05
intraductal papillary-mucinous neoplasm ... 2.200 1.6e-03
medulloblastoma, large-cell -2.600 1.8e-03
oligodendroglioma -2.400 1.6e-03
osteosarcoma -2.420 4.7e-06
pediatric high grade glioma -1.500 1.9e-02
Pick disease -1.700 8.2e-04
primitive neuroectodermal tumor -2.500 3.8e-04
spina bifida -2.597 2.8e-02

AA Sequence

MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIM      1 - 70
DTISDRLRIPWLRGAKKVNISIIPPLVLLPVFLHVASWHFLLGVVVLTSLPVLALWYYYLTHRRKEQTLF     71 - 140
FLSLGLFSLGYMYYVFLQEVVPKGRVGPVQLAVLTCGLFLILLALHRAKKNPGYLSNPASGDRSLSSSQL    141 - 210
ECLSRKGQEKTKGFPGADMSGSLNNRTTKDDPKGSSKMPAGSPTKAKEDWCAKCQLVRPARAWHCRICGI    211 - 280
CVRRMDHHCVWINSCVGESNHQAFILALLIFLLTSVYGITLTLDTICRDRSVFTALFYCPGVYANYSSAL    281 - 350
SFTCVWYSVIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTGLLG               351 - 409
//

Text Mined References (10)

PMID Year Title