Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q8IYN6
Symbols FAM100B

Gene

PDB

2DZL  

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
18976975 Knockdown of family with sequence similarity 100, member B (FAM100B) by siRNA regulates on HIV-1 life cycle in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication

AA Sequence

MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPA      1 - 70
TPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQ     71 - 140
PTWPPGAQQGGAQQKAMAAMDGQR                                                  141 - 164
//

Text Mined References (3)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.