Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis and treatment for 6 months 686 5.16605260633505E-5
ovarian cancer 8492 0.00132760282329785
acute myeloid leukemia 785 0.00761384420344996
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0310338674581561

Expression

  Differential Expression (4)

Gene RIF (1)

PMID Text
18976975 Knockdown of family with sequence similarity 100, member B (FAM100B) by siRNA regulates on HIV-1 life cycle in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication

AA Sequence

MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPA      1 - 70
TPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQ     71 - 140
PTWPPGAQQGGAQQKAMAAMDGQR                                                  141 - 164
//

Text Mined References (3)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.