UBA-like domain-containing protein 2

Property Summary

NCBI Gene PubMed Count	2
PubMed Score	0.07

Knowledge Summary

Patent

No data available

TINX Plot

Disease (1)

Expression Atlas

Disease	Target Count	P-value
ovarian cancer	8520	1.3e-03
tuberculosis	2010	2.3e-03
acute myeloid leukemia	783	7.6e-03
intraductal papillary-mucinous neoplasm (IPMN)	3291	3.1e-02

Expression

Specificity
Differential

Differential Expression (4)

Disease	log2 FC	p
acute myeloid leukemia	1.300	7.6e-03
intraductal papillary-mucinous neoplasm ...	1.100	3.1e-02
ovarian cancer	1.100	1.3e-03
tuberculosis	1.100	2.3e-03

Cells - EBV-transformed lymphocytes 18,186

Whole Blood 17,439

Lung 18,057

Esophagus - Mucosa 18,076

Spleen 17,614

Small Intestine - Terminal Ileum 17,954

Skin - Not Sun Exposed (Suprapubic) 18,081

Colon - Transverse 17,825

Skin - Sun Exposed (Lower leg) 17,968

Nerve - Tibial 18,007

Vagina 17,834

Thyroid 18,024

Cells - Transformed fibroblasts 17,577

Breast - Mammary Tissue 18,103

Stomach 17,879

Prostate 18,213

Artery - Coronary 17,949

Artery - Aorta 17,896

Adipose - Visceral (Omentum) 17,937

Adipose - Subcutaneous 18,110

Minor Salivary Gland 18,005

Brain - Spinal cord (cervical c-1) 17,973

Uterus 17,618

Colon - Sigmoid 18,089

Esophagus - Gastroesophageal Junction 18,000

Testis 18,518

Muscle - Skeletal 17,778

Esophagus - Muscularis 18,017

Artery - Tibial 17,631

Brain - Cerebellum 17,983

Brain - Frontal Cortex (BA9) 18,069

Pituitary 18,147

Brain - Cerebellar Hemisphere 18,015

Brain - Substantia nigra 17,981

Brain - Hypothalamus 18,169

Brain - Cortex 18,039

Adrenal Gland 18,071

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Hippocampus 18,011

Heart - Atrial Appendage 17,896

Brain - Amygdala 18,006

Brain - Nucleus accumbens (basal ganglia... 18,024

Ovary 17,971

Brain - Caudate (basal ganglia) 18,001

Brain - Putamen (basal ganglia) 17,863

Kidney - Cortex 17,329

Pancreas 18,123

Heart - Left Ventricle 18,006

Liver 18,071

Fetal Brain 7,866

Adult Colon 7,915

Brain

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Synonym

Accession	Q8IYN6
Symbols	FAM100B

Gene

UBALD2

PDB

2DZL

Ortholog (1)

Species	Source	Disease
Chimp	OMA EggNOG

UniProt Keyword (4)

Complete proteome 20,231

Reference proteome 20,231

Acetylation 3,409

3D-structure 6,226

Compartment GO Term (0)

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Gene RIF (1)

AA Sequence

MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPA      1 - 70
TPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQ     71 - 140
PTWPPGAQQGGAQQKAMAAMDGQR                                                  141 - 164
//

Text Mined References (3)

Summary
Details

	PMID	Year	Title