Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 1.300 7.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.1e-02
ovarian cancer 1.100 1.3e-03
tuberculosis 1.100 2.3e-03

Gene RIF (1)

AA Sequence

MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPA      1 - 70
TPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQ     71 - 140
PTWPPGAQQGGAQQKAMAAMDGQR                                                  141 - 164
//

Text Mined References (3)

PMID Year Title