Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
autosomal dominant Emery-Dreifuss muscul... 1.044 1.9e-03
Breast cancer 2.800 2.5e-02
diabetes mellitus -1.100 1.2e-03
Duchenne muscular dystrophy 1.236 1.3e-08
juvenile dermatomyositis 1.196 2.0e-10
ovarian cancer -2.000 1.4e-04

Gene RIF (1)

AA Sequence

MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHL      1 - 70
DPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP                            71 - 117
//

Text Mined References (5)

PMID Year Title