Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Duchenne muscular dystrophy 1.236 0.000
autosomal dominant Emery-Dreifuss muscul... 1.044 0.002
juvenile dermatomyositis 1.196 0.000
diabetes mellitus -1.100 0.001
Breast cancer 2.800 0.025
ovarian cancer -2.000 0.000

Gene RIF (1)

PMID Text
10051408 Characterizes TCEAL1, another member of the human TCEAL gene family.

AA Sequence

MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHL      1 - 70
DPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP                            71 - 117
//

Text Mined References (5)

PMID Year Title
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10051408 1999 Genomic structure and chromosomal localization of TCEAL1, a human gene encoding the nuclear phosphoprotein p21/SIIR.