Property Summary

NCBI Gene PubMed Count 49
Grant Count 7
Funding $437,992
PubMed Score 40.51
PubTator Score 48.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Gene RIF (47)

PMID Text
26683615 Demonstrated that TRIM22 acts as a negative regulator of HIV-1 replication via inhibition of basal Sp1-driven proviral transcription.
26316153 propose that TRIM22 is a direct target gene of PR and that it can mediate progesterone actions in uterine cells
26271984 Data show that capsid protein p24-DsRed-Monomer was co-localized with tripartite motif containing 22 (TRIM22)-EGFP in HEK293T cells.
26237181 regulation of FoxO4 protein expression and cell survival by TRIM22 controls TLR3-mediated IFN type I gene induction, preventing excessive antiviral response through dsRNA-induced apoptosis.
25683609 Interferon-alpha-induced TRIM22 interrupts hepatitis c virus replication by ubiquitinating NS5A.
25510414 TRIM22 could interact with IkappaB kinase (IKK)alpha but not IKKbeta and could increase the level and phosphorylation of IKKalpha through its really interesting new gene (RING) and spla-ryanodine receptor (SPRY) domains.
24983760 A number of putative structural and functional residues, including several sites that undergo post-translational modification, were also identified in TRIM22.
24889558 Upregulation of TRIM22 may be associated with responsiveness to Peg-IFNalpha-2a/RBV combination therapy in hepatitis C.
24863734 our data characterize the extensive genetic variation in TRIM22 and identify rs1063303:G>C as a highly prevalent SNP that influences its function.
24742347 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
24742347 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
24478420 TRIM5alpha and TRIM22 have differential transcriptional regulation and distinct anti-HIV roles according to infection phase.
24183724 this study shows that TRIM22 is greatly under-expressed in breast cancer. p53 dysfunction may be one of the mechanisms for TRIM22 down-regulation.
24162774 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
24066097 Data report that markers in two TRIMs, TRIM5 and TRIM22 and a marker in BST2, associated statistically with the risk of getting MS.
23921607 TRIM22 genetic diversity affects HIV-1 replication in vitro and it is a potentially novel determinant of HIV-1 disease severity
23867815 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
23818111 These data indicate that overexpression of TRIM22 may negatively regulate the TRAF6-stimulated NF-kappaB pathway by interacting with and degrading TAB2.
23670564 p300 contributed to both IFN-gamma- and IRF-1-mediated TRIM22 transcription independent of its histone acetyltransferase activity, however, it was required for the recruitment of RNA polymerase II to TRIM22 promoter region.
23408607 Restriction of influenza A virus replication was accounted for by the interaction between TRIM22 and the viral nucleoprotein (NP), resulting in its polyubiquitination and degradation in a proteasome-dependent manner
22509910 TRIM22 to repress protein translation preferably of some specific mRNAs. TRIM22 represses translation by inhibiting the binding of eIF4E to eIF4G, suggesting a mechanism for regulation of protein translation
21683060 BRG1-mediated chromatin remodeling is critical for the IFN-gamma-inducibility of TRIM22 gene.
21651891 These data suggested that TRIM22 was a positive regulator of NF-kappaB-mediated transcription.
21345949 Nuclear TRIM22 significantly impairs HIV-1 replication, likely by interfering with Tat- and NF-kappaB-independent long-terminal-repeat-driven transcription.
21345949 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
21264255 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
20980524 These data suggest concordance between type 1 IFN and TRIM22 in PBMCs and that TRIM22 likely acts as an antiviral effector in HIV-1 infection.
20006605 endogenous TRIM22 is localized to both nucleus and cytosol in primary human mononuclear cells, as well as in the human osteosarcoma cell line U2OS
20001730 Specific polymorphisms in tripartite motif22 (TRIM22) genes were significantly associated with rubella vaccine humoral immunity
19943174 REVIEW: current knowledge on the anti-retroviral effects of TRIM5 alpha and TRIM22
19902255 Observational study of gene-disease association. (HuGE Navigator)
19694548 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
19585648 TRIM22-mediated anti-hepatitis B virus activity dependent on the nuclear-located RING domain
19481078 Deletion of putative nuclear localization signal abolished TRIM22 localization and nuclear body (NB) formation, the B30.2/SplA and ryanodine receptor (SPRY) domain, and residues 491-494 specifically are essential for nuclear localization and NB formation.
19218198 TRIM22 is an E3 Ubiquitin ligase whose expression leads to antiviral effects towards Encephalomyocarditis virus infections in HeLa cells. [TRIM22]
19212762 Study shows that human and rhesus TRIM22 localise to different subcellular compartments and that this difference can be assigned to the positively selected B30.2 domain.
18656448 A novel property of TRIM22, E3 ubiquitin ligase activity, was demonstrated.
18389079 TRIM22 inhibits HIV-1 particle production by interfering with the trafficking of Gag to the plasma membrane and is a key player in the antiviral activity of the Type I interferon response to HIV-1.
18389079 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
18389079 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
17970695 These data suggest a more complex role for TRIM22 during T lymphocyte activation than merely as an antiproliferative factor.
16926043 Overexpression of Staf50 inhibited the HIV-1 infection between 50% and 90% in 293 T CD4/CCR5 as well as in monocyte-derived macrophages.
16926043 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
16926043 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
15064739 May be involved in proliferation and/or differentiation of leukemic cells.
12539042 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
7797467 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages

AA Sequence

MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIISRGESSCPVCQTRFQPGNLRP      1 - 70
NRHLANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQEHQGHQTFRINEVVKEC     71 - 140
QEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEV    141 - 210
NVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV    211 - 280
PDLSGMLQVLKELTDVQYYWVDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYF    281 - 350
SSGKYYWEVDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYWVIGLQNTCEYNA    351 - 420
FEDSSSSDPKVLTLFMAVPPCRIGVFLDYEAGIVSFFNVTNHGALIYKFSGCRFSRPAYPYFNPWNCLVP    421 - 490
MTVCPPSS                                                                  491 - 498
//

Text Mined References (51)

PMID Year Title
26683615 2015 HIV-1 transcriptional silencing caused by TRIM22 inhibition of Sp1 binding to the viral promoter.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26316153 2015 Identification of TRIM22 as a progesterone-responsive gene in Ishikawa endometrial cancer cells.
26271984 2015 [Expressions and co-localization of HIV capsid protein p24 and TRIM22 in HEK293T cells].
26237181 2015 Control of FoxO4 Activity and Cell Survival by TRIM22 Directs TLR3-Stimulated Cells Toward IFN Type I Gene Induction or Apoptosis.
25683609 2016 Interferon alpha (IFN?)-induced TRIM22 interrupts HCV replication by ubiquitinating NS5A.
25510414 2015 TRIM22 can activate the noncanonical NF-?B pathway by affecting IKK?.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24983760 2014 In silico analysis of functional single nucleotide polymorphisms in the human TRIM22 gene.
24889558 2014 Associations between human TRIM22 gene expression and the response to combination therapy with Peg-IFN?-2a and ribavirin in Iranian patients with chronic hepatitis C.
24863734 2014 Ancient and recent adaptive evolution in the antiviral TRIM22 gene: identification of a single-nucleotide polymorphism that impacts TRIM22 function.
24478420 2014 TRIM5? and TRIM22 are differentially regulated according to HIV-1 infection phase and compartment.
24183724 2013 Down-regulation of tripartite-motif containing 22 expression in breast cancer is associated with a lack of p53-mediated induction.
24066097 2013 Restriction genes for retroviruses influence the risk of multiple sclerosis.
23921607 2013 Identification of TRIM22 single nucleotide polymorphisms associated with loss of inhibition of HIV-1 transcription and advanced HIV-1 disease.
23818111 2013 TRIM22 inhibits the TRAF6-stimulated NF-?B pathway by targeting TAB2 for degradation.
23670564 2013 p300, but not PCAF, collaborates with IRF-1 in stimulating TRIM22 expression independently of its histone acetyltransferase activity.
23408607 2013 TRIM22 inhibits influenza A virus infection by targeting the viral nucleoprotein for degradation.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22509910 2012 The p53 target gene TRIM22 directly or indirectly interacts with the translation initiation factor eIF4E and inhibits the binding of eIF4E to eIF4G.
21683060 2011 BRG1 is indispensable for IFN-?-induced TRIM22 expression, which is dependent on the recruitment of IRF-1.
21651891 2011 Identification of tripartite motif-containing 22 (TRIM22) as a novel NF-?B activator.
21345949 2011 TRIM22 inhibits HIV-1 transcription independently of its E3 ubiquitin ligase activity, Tat, and NF-kappaB-responsive long terminal repeat elements.
21269460 2011 Initial characterization of the human central proteome.
20980524 2011 Association of TRIM22 with the type 1 interferon response and viral control during primary HIV-1 infection.
20006605 2010 The human IFN-inducible p53 target gene TRIM22 colocalizes with the centrosome independently of cell cycle phase.
20001730 2010 Polymorphisms in the vitamin A receptor and innate immunity genes influence the antibody response to rubella vaccination.
19943174 2010 Restriction factors of retroviral replication: the example of Tripartite Motif (TRIM) protein 5 alpha and 22.
19902255 2010 Rubella vaccine-induced cellular immunity: evidence of associations with polymorphisms in the Toll-like, vitamin A and D receptors, and innate immune response genes.
19585648 2009 Tripartite motif-containing 22 inhibits the activity of hepatitis B virus core promoter, which is dependent on nuclear-located RING domain.
19481078 2009 B30.2/SPRY domain in tripartite motif-containing 22 is essential for the formation of distinct nuclear bodies.
19331816 2009 Dynamic localization of tripartite motif-containing 22 in nuclear and nucleolar bodies.
19218198 2009 TRIM22 E3 ubiquitin ligase activity is required to mediate antiviral activity against encephalomyocarditis virus.
19212762 2009 Different subcellular localisations of TRIM22 suggest species-specific function.
18656448 2008 Identification of TRIM22 as a RING finger E3 ubiquitin ligase.
18389079 2008 The interferon response inhibits HIV particle production by induction of TRIM22.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17970695 2007 Regulation of the interferon-inducible p53 target gene TRIM22 (Staf50) in human T lymphocyte activation.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17156811 2007 Unique features of TRIM5alpha among closely related human TRIM family members.
16926043 2006 Stimulated trans-acting factor of 50 kDa (Staf50) inhibits HIV-1 replication in human monocyte-derived macrophages.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15064739 2004 Staf50 is a novel p53 target gene conferring reduced clonogenic growth of leukemic U-937 cells.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11331580 2001 The tripartite motif family identifies cell compartments.
11096452 2000 The interferon-inducible Staf50 gene is downregulated during T cell costimulation by CD2 and CD28.
8661041 1996 Localization of Staf50, a member of the Ring finger family, to 11p15 by fluorescence in situ hybridization.
7797467 1995 Molecular cloning of a new interferon-induced factor that represses human immunodeficiency virus type 1 long terminal repeat expression.