Property Summary

NCBI Gene PubMed Count 49
Grant Count 7
Funding $437,992
PubMed Score 40.51
PubTator Score 48.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Gene RIF (47)

PMID Text
26683615 Demonstrated that TRIM22 acts as a negative regulator of HIV-1 replication via inhibition of basal Sp1-driven proviral transcription.
26316153 propose that TRIM22 is a direct target gene of PR and that it can mediate progesterone actions in uterine cells
26271984 Data show that capsid protein p24-DsRed-Monomer was co-localized with tripartite motif containing 22 (TRIM22)-EGFP in HEK293T cells.
26237181 regulation of FoxO4 protein expression and cell survival by TRIM22 controls TLR3-mediated IFN type I gene induction, preventing excessive antiviral response through dsRNA-induced apoptosis.
25683609 Interferon-alpha-induced TRIM22 interrupts hepatitis c virus replication by ubiquitinating NS5A.
25510414 TRIM22 could interact with IkappaB kinase (IKK)alpha but not IKKbeta and could increase the level and phosphorylation of IKKalpha through its really interesting new gene (RING) and spla-ryanodine receptor (SPRY) domains.
24983760 A number of putative structural and functional residues, including several sites that undergo post-translational modification, were also identified in TRIM22.
24889558 Upregulation of TRIM22 may be associated with responsiveness to Peg-IFNalpha-2a/RBV combination therapy in hepatitis C.
24863734 our data characterize the extensive genetic variation in TRIM22 and identify rs1063303:G>C as a highly prevalent SNP that influences its function.
24742347 HIV-1 and the viral protein Tat modulate the expression of tripartite motif-containing 22 (TRIM22; STAF50) in immature dendritic cells and monocyte-derived macrophages
More...

AA Sequence

MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIISRGESSCPVCQTRFQPGNLRP      1 - 70
NRHLANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQEHQGHQTFRINEVVKEC     71 - 140
QEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEV    141 - 210
NVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV    211 - 280
PDLSGMLQVLKELTDVQYYWVDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYF    281 - 350
SSGKYYWEVDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYWVIGLQNTCEYNA    351 - 420
FEDSSSSDPKVLTLFMAVPPCRIGVFLDYEAGIVSFFNVTNHGALIYKFSGCRFSRPAYPYFNPWNCLVP    421 - 490
MTVCPPSS                                                                  491 - 498
//

Text Mined References (51)

PMID Year Title
26683615 2015 HIV-1 transcriptional silencing caused by TRIM22 inhibition of Sp1 binding to the viral promoter.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26316153 2015 Identification of TRIM22 as a progesterone-responsive gene in Ishikawa endometrial cancer cells.
26271984 2015 [Expressions and co-localization of HIV capsid protein p24 and TRIM22 in HEK293T cells].
26237181 2015 Control of FoxO4 Activity and Cell Survival by TRIM22 Directs TLR3-Stimulated Cells Toward IFN Type I Gene Induction or Apoptosis.
25683609 2016 Interferon alpha (IFN?)-induced TRIM22 interrupts HCV replication by ubiquitinating NS5A.
25510414 2015 TRIM22 can activate the noncanonical NF-?B pathway by affecting IKK?.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24983760 2014 In silico analysis of functional single nucleotide polymorphisms in the human TRIM22 gene.
24889558 2014 Associations between human TRIM22 gene expression and the response to combination therapy with Peg-IFN?-2a and ribavirin in Iranian patients with chronic hepatitis C.
More...