Property Summary

NCBI Gene PubMed Count 53
PubMed Score 43.28
PubTator Score 48.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 3.651 1.7e-04
active ulcerative colitis 3.273 1.8e-04
adrenocortical carcinoma -1.554 1.3e-02
adult high grade glioma 1.900 1.8e-03
astrocytoma 1.300 1.2e-09
Astrocytoma, Pilocytic 2.000 7.5e-08
autosomal dominant Emery-Dreifuss muscul... 1.196 1.8e-02
Breast cancer -1.400 1.4e-04
cutaneous lupus erythematosus 2.200 2.8e-04
dermatomyositis 2.200 1.9e-03
Duchenne muscular dystrophy 1.495 4.0e-06
ependymoma 1.200 6.6e-03
glioblastoma 1.200 1.9e-02
group 3 medulloblastoma -1.100 3.8e-02
juvenile dermatomyositis 3.268 4.6e-19
lung cancer -2.800 3.4e-06
lung carcinoma -3.000 5.2e-38
malignant mesothelioma -2.600 2.4e-07
medulloblastoma, large-cell -2.000 8.8e-06
Multiple Sclerosis 1.800 4.4e-03
non-small cell lung cancer -1.467 4.8e-12
ovarian cancer -3.100 2.0e-05
pituitary cancer -1.100 1.3e-02
primary Sjogren syndrome 2.300 7.6e-04
psoriasis 1.500 4.3e-07
subependymal giant cell astrocytoma 2.982 5.1e-03
Waldenstrons macroglobulinemia 1.321 2.7e-02

Gene RIF (48)

AA Sequence

MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIISRGESSCPVCQTRFQPGNLRP      1 - 70
NRHLANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQEHQGHQTFRINEVVKEC     71 - 140
QEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEV    141 - 210
NVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV    211 - 280
PDLSGMLQVLKELTDVQYYWVDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYF    281 - 350
SSGKYYWEVDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYWVIGLQNTCEYNA    351 - 420
FEDSSSSDPKVLTLFMAVPPCRIGVFLDYEAGIVSFFNVTNHGALIYKFSGCRFSRPAYPYFNPWNCLVP    421 - 490
MTVCPPSS                                                                  491 - 498
//

Text Mined References (55)

PMID Year Title