Property Summary

NCBI Gene PubMed Count 17
PubMed Score 25.00
PubTator Score 15.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
SPERMATOGENIC FAILURE 10 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.3e-04
Disease Target Count Z-score Confidence
Male infertility 206 4.159 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.102 2.3e-04

Gene RIF (9)

AA Sequence

MDPLRRSPSPCLSSQPSSPSTPPCEMLGPVGIEAVLDQLKIKAMKMGFEFNIMVVGQSGLGKSTMVNTLF      1 - 70
KSKVWKSNPPGLGVPTPQTLQLHSLTHVIEEKGVKLKLTVTDTPGFGDQINNDNCWDPILGYINEQYEQY     71 - 140
LQEEILITRQRHIPDTRVHCCVYFVPPTGHCLRPLDIEFLQRLCRTVNVVPVIARADSLTMEEREAFRRR    141 - 210
IQQNLRTHCIDVYPQMCFDEDINDKILNSKLRDRIPFAVVGADQEHLVNGRCVLGRKTKWGIIEVENMAH    211 - 280
CEFPLLRDLLIRSHLQDLKDITHNIHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGA    281 - 350
HDDSDDEF                                                                  351 - 358
//

Text Mined References (22)

PMID Year Title