Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.37
PubTator Score 0.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.700 0.000
adult high grade glioma 1.100 0.009
ovarian cancer 1.200 0.000

AA Sequence

MEKDDPPQLVTPTSVKAIILRIEAAQLTRAQEDISTQLSDILDNVNCVINRFQEELGYDLKENAKSQQRD      1 - 70
PKGKKRFILLEKIASFSKDAMMKEKHLYDILRWLGDWGDTLTYEIGPRKSEEEAAALDEWIEVTEKVLPL     71 - 140
SLIATKRGIESLTALCSTLIEGQKKRSQVSKRTFWQGWQGRSPQTSPSHPQPLSPEQMLQDQHTMNTKAS    141 - 210
EVTSMLQELLDSTMFSKGEVRAIRYMATVVENLNKALILQHKENRSLETKYRHLQMQATKELSSQRLHFQ    211 - 280
QFMEVLESRRDALLKQVEILGGRYHDLLLMKQALEFQLKKAQNATGQAEDLAEVSVDSPGPSERETLPRK    281 - 350
ETVMEESQQEPMKEEQLFSPLPPSPMAMIRDSGAIAAGHQPLSTMTVRSRVADVFGSKDTESLEPVLLPL    351 - 420
VDRRFPKKWERPVAESLGHKDKDQEDYFQKGGLQIKFHCSKQLSLESSRQVTSESQEEPWEEEFGREMRR    421 - 490
QLWLEEEEMWQQRQKKWALLEQEHQEKLRQWNLEDLAREQQRRWVQLEKEQESPRREPEQLGEDVERRIF    491 - 560
TPTSRWRDLEKAELSLVPAPSRTQSAHQSRRPHLPMSPSTQQPALGKQRPMSSVEFTYRPRTRRVPTKPK    561 - 630
KSASFPVTGTSIRRLTWPSLQISPANIKKKVYHMDMEAQRKNLQLLSEESELRLPHYLRSKALELTTTTM    631 - 700
ELGALRLQYLCHKYIFYRRLQSLRQEAINHVQIMKETEASYKAQNLYIFLENIDRLQSLRLQAWTDKQKG    701 - 770
LEEKHRECLSSMVTMFPKLQLEWNVHLNIPEVTSPKPKKCKLPAASPRHIRPSGPTYKQPFLSRHRACVP    771 - 840
LQMARQQGKQMEAVWKTEVASSSYAIEKKTPASLPRDQLRGHPDIPRLLTLDV                     841 - 893
//

Text Mined References (11)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...