Property Summary

NCBI Gene PubMed Count 21
PubMed Score 38.47
PubTator Score 18.68

Knowledge Summary

Patent (4,512)

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.600 3.1e-03
Astrocytoma, Pilocytic 2.200 2.9e-10
Chronic Lymphocytic Leukemia -1.027 6.6e-03
cutaneous lupus erythematosus 2.900 1.1e-04
ependymoma 1.100 2.6e-04
glioblastoma 1.500 8.3e-05
head and neck cancer and chronic obstruc... 1.100 4.9e-03
interstitial cystitis 1.700 2.8e-03
lung adenocarcinoma -1.239 9.8e-06
lung cancer -1.900 1.6e-05
lung carcinoma -2.100 3.6e-20
mucosa-associated lymphoid tissue lympho... 1.731 3.5e-02
non-small cell lung cancer -1.740 1.1e-17
ovarian cancer -1.100 7.1e-04
primary Sjogren syndrome 1.500 4.9e-03
psoriasis 1.100 7.5e-30
ulcerative colitis 1.800 1.5e-04

 CSPA Cell Line (2)

Gene RIF (11)

AA Sequence

MNSTCIEEQHDLDHYLFPIVYIFVIIVSIPANIGSLCVSFLQAKKESELGIYLFSLSLSDLLYALTLPLW      1 - 70
IDYTWNKDNWTFSPALCKGSAFLMYMNFYSSTAFLTCIAVDRYLAVVYPLKFFFLRTRRFALMVSLSIWI     71 - 140
LETIFNAVMLWEDETVVEYCDAEKSNFTLCYDKYPLEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAV    141 - 210
RHNKATENKEKKRIIKLLVSITVTFVLCFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTS    211 - 280
LNCVADPILYCFVTETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE                 281 - 337
//

Text Mined References (21)

PMID Year Title