Property Summary

NCBI Gene PubMed Count 20
Grant Count 17
R01 Count 11
Funding $2,202,201.17
PubMed Score 31.91
PubTator Score 18.68

Knowledge Summary

Patent (4,512)

Expression

Gene RIF (10)

PMID Text
24152439 TDAG8 expression is decreased by more than 50%.
23707809 GPR65 is a regulator upstream of MMP3, which is regulated by proton-sensing G-protein-coupled receptors
22685289 Acidosis promotes Bcl-2 family-mediated evasion of apoptosis: involvement of acid-sensing G protein-coupled receptor Gpr65 signaling to Mek/Erk.
22445881 Data suggest that one physiological function of TDAG8 is negative regulation of inflammation by inhibiting production of pro-inflammatory cytokines in T-lymphocytes and macrophages.
20855608 These results support the hypothesis that TDAG8 enhances tumor development by promoting adaptation to the acidic environment to enhance cell survival/proliferation.
19234222 At least partly, TDGA8 mediates extracellular acidification-induced inhibition of proinflammatory cytokine production through the Gs protein/cyclic AMP-dependent protein kinase A signaling pathway in transgenic mouse macrophages.
15665078 Expression of TDAG8 by immune cells may regulate responses in acidic microenvironments.
15618224 TDAG8 may play biological roles in immune response and cellular transformation under conditions accompanying tissue acidosis.
15326175 TDAG8 is one of the proton-sensing GPCRs coupling to adenylyl cyclase and psychosine, and its related lysosphingolipids behave as if they were antagonists against protein-sensing receptors, including TDAG8, GPR4, and OGR1.
15221007 GPR4 and TDAG8 overexpression in human tumors plays a role in driving or maintaining tumor formation

AA Sequence

MNSTCIEEQHDLDHYLFPIVYIFVIIVSIPANIGSLCVSFLQAKKESELGIYLFSLSLSDLLYALTLPLW      1 - 70
IDYTWNKDNWTFSPALCKGSAFLMYMNFYSSTAFLTCIAVDRYLAVVYPLKFFFLRTRRFALMVSLSIWI     71 - 140
LETIFNAVMLWEDETVVEYCDAEKSNFTLCYDKYPLEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAV    141 - 210
RHNKATENKEKKRIIKLLVSITVTFVLCFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTS    211 - 280
LNCVADPILYCFVTETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE                 281 - 337
//

Text Mined References (20)

PMID Year Title
24962563 2014 Genome-wide genetic and transcriptomic investigation of variation in antibody response to dietary antigens.
24152439 2013 Acidosis decreases c-Myc oncogene expression in human lymphoma cells: a role for the proton-sensing G protein-coupled receptor TDAG8.
23707809 2013 Identification of GPR65, a novel regulator of matrix metalloproteinases using high through-put screening.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22685289 2012 Acidosis promotes Bcl-2 family-mediated evasion of apoptosis: involvement of acid-sensing G protein-coupled receptor Gpr65 signaling to Mek/Erk.
22445881 2012 Activation of T cell death-associated gene 8 regulates the cytokine production of T cells and macrophages in vitro.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20855608 2010 The G protein-coupled receptor T-cell death-associated gene 8 (TDAG8) facilitates tumor development by serving as an extracellular pH sensor.
19234222 2009 Involvement of proton-sensing TDAG8 in extracellular acidification-induced inhibition of proinflammatory cytokine production in peritoneal macrophages.
More...