Property Summary

NCBI Gene PubMed Count 20
PubMed Score 31.91
PubTator Score 18.68

Knowledge Summary

Patent (4,512)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 7.53062004572273E-30
lung carcinoma 2844 3.6289457857424E-20
non-small cell lung cancer 2798 1.08384651359526E-17
chronic lymphosyte leukemia 232 5.75723427978085E-13
pilocytic astrocytoma 3086 3.14514774987358E-10
lung adenocarcinoma 2714 9.79238417371617E-6
lung cancer 4473 1.61648696243957E-5
posterior fossa group A ependymoma 1511 2.99246437335383E-5
cutaneous lupus erythematosus 1056 1.05842706238993E-4
ulcerative colitis 2087 1.53308559580113E-4
glioblastoma 5572 1.54726064191649E-4
pediatric high grade glioma 2712 2.55862079308766E-4
ovarian cancer 8492 7.07385573225633E-4
interstitial cystitis 2299 0.00277117390536113
primary Sjogren syndrome 789 0.00485150560785398
head and neck cancer and chronic obstructive pulmonary disease 237 0.00491472102005004
mucosa-associated lymphoid tissue lymphoma 480 0.0352759589586509
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 1.0
Crohn's disease 304 0.0 2.0
Multiple Sclerosis 498 0.0 2.0
Disease Target Count Z-score Confidence
Rectal prolapse 12 3.059 1.5

Expression

Synonym

Accession Q8IYL9 O75819
Symbols TDAG8
hTDAG8

Gene

PANTHER Protein Class (2)

  Ortholog (11)

  TechDev Info (1)

 CSPA Cell Line (2)

Gene RIF (10)

PMID Text
24152439 TDAG8 expression is decreased by more than 50%.
23707809 GPR65 is a regulator upstream of MMP3, which is regulated by proton-sensing G-protein-coupled receptors
22685289 Acidosis promotes Bcl-2 family-mediated evasion of apoptosis: involvement of acid-sensing G protein-coupled receptor Gpr65 signaling to Mek/Erk.
22445881 Data suggest that one physiological function of TDAG8 is negative regulation of inflammation by inhibiting production of pro-inflammatory cytokines in T-lymphocytes and macrophages.
20855608 These results support the hypothesis that TDAG8 enhances tumor development by promoting adaptation to the acidic environment to enhance cell survival/proliferation.
19234222 At least partly, TDGA8 mediates extracellular acidification-induced inhibition of proinflammatory cytokine production through the Gs protein/cyclic AMP-dependent protein kinase A signaling pathway in transgenic mouse macrophages.
15665078 Expression of TDAG8 by immune cells may regulate responses in acidic microenvironments.
15618224 TDAG8 may play biological roles in immune response and cellular transformation under conditions accompanying tissue acidosis.
15326175 TDAG8 is one of the proton-sensing GPCRs coupling to adenylyl cyclase and psychosine, and its related lysosphingolipids behave as if they were antagonists against protein-sensing receptors, including TDAG8, GPR4, and OGR1.
15221007 GPR4 and TDAG8 overexpression in human tumors plays a role in driving or maintaining tumor formation

AA Sequence

MNSTCIEEQHDLDHYLFPIVYIFVIIVSIPANIGSLCVSFLQAKKESELGIYLFSLSLSDLLYALTLPLW      1 - 70
IDYTWNKDNWTFSPALCKGSAFLMYMNFYSSTAFLTCIAVDRYLAVVYPLKFFFLRTRRFALMVSLSIWI     71 - 140
LETIFNAVMLWEDETVVEYCDAEKSNFTLCYDKYPLEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAV    141 - 210
RHNKATENKEKKRIIKLLVSITVTFVLCFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTS    211 - 280
LNCVADPILYCFVTETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE                 281 - 337
//

Text Mined References (20)

PMID Year Title
24962563 2014 Genome-wide genetic and transcriptomic investigation of variation in antibody response to dietary antigens.
24152439 2013 Acidosis decreases c-Myc oncogene expression in human lymphoma cells: a role for the proton-sensing G protein-coupled receptor TDAG8.
23707809 2013 Identification of GPR65, a novel regulator of matrix metalloproteinases using high through-put screening.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22685289 2012 Acidosis promotes Bcl-2 family-mediated evasion of apoptosis: involvement of acid-sensing G protein-coupled receptor Gpr65 signaling to Mek/Erk.
22445881 2012 Activation of T cell death-associated gene 8 regulates the cytokine production of T cells and macrophages in vitro.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20855608 2010 The G protein-coupled receptor T-cell death-associated gene 8 (TDAG8) facilitates tumor development by serving as an extracellular pH sensor.
19234222 2009 Involvement of proton-sensing TDAG8 in extracellular acidification-induced inhibition of proinflammatory cytokine production in peritoneal macrophages.
More...