Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
dermatomyositis 967 1.80717154942907E-4
ovarian cancer 8492 8.10758497747472E-4
group 3 medulloblastoma 2254 0.00323885054094713
lung cancer 4473 0.00818037167099121

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.700 0.003
lung cancer 1.100 0.008
ovarian cancer 1.800 0.001
dermatomyositis 1.300 0.000

Synonym

Accession Q8IYL3 A8K0C8 A8MUG9 Q5SR20 Q6NX36
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MRSRKLTGAVRSSARLKARSCSAARLASAQEVAGSTSAKTACLTSSSHKATDTRTSKKFKCDKGHLVKSE      1 - 70
LQKLVPKNDSASLPKVTPETPCENEFAEGSALLPGSEAGVSVQQGAASLPLGGCRVVSDSRLAKTRDGLS     71 - 140
VPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPP    141 - 210
ASSSCPSMSRREFRKMHFRAKDDDDDDDDDAEM                                         211 - 243
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22361696 2012 Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...