Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
dermatomyositis 966 1.8e-04
ovarian cancer 8520 8.1e-04
group 3 medulloblastoma 4104 3.2e-03
lung cancer 4740 8.2e-03
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 197 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.300 1.8e-04
group 3 medulloblastoma 1.700 3.2e-03
lung cancer 1.100 8.2e-03
ovarian cancer 1.800 8.1e-04

Synonym

Accession Q8IYL3 A8K0C8 A8MUG9 Q5SR20 Q6NX36
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRSRKLTGAVRSSARLKARSCSAARLASAQEVAGSTSAKTACLTSSSHKATDTRTSKKFKCDKGHLVKSE      1 - 70
LQKLVPKNDSASLPKVTPETPCENEFAEGSALLPGSEAGVSVQQGAASLPLGGCRVVSDSRLAKTRDGLS     71 - 140
VPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPP    141 - 210
ASSSCPSMSRREFRKMHFRAKDDDDDDDDDAEM                                         211 - 243
//

Text Mined References (14)

PMID Year Title