Property Summary

NCBI Gene PubMed Count 13
PubMed Score 35.97
PubTator Score 26.24

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.500 4.6e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-03
medulloblastoma, large-cell 1.200 4.3e-03
osteosarcoma -1.277 7.9e-06
primitive neuroectodermal tumor 1.800 3.1e-02

Gene RIF (7)

AA Sequence

MHTDLDTDMDMDTETTALCPSGSRRASPPGTPTPEADATLLKKSEKLLAELDRSGLPSAPGAPRRRGSMP      1 - 70
VPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSGEAAPAQKDGIFKVMLVGESGVGKSTLAGTFGGLQGD     71 - 140
SAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETL    141 - 210
LRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLR    211 - 280
RGRNHAGGQRPDPGSPEGPAPPARRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL              281 - 340
//

Text Mined References (14)

PMID Year Title