Property Summary

NCBI Gene PubMed Count 13
Grant Count 9
R01 Count 2
Funding $705,088.54
PubMed Score 32.35
PubTator Score 26.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (7)

PMID Text
23991227 conclude that endogenous Rem2 is a positive regulator of functional, excitatory synapse development and a negative regulator of dendritic complexity
22815963 Rem2 has a role in neuronal plasticity hrough co-trafficking with CaMKIIa
21980534 molecular mechanisms by which Rem2 knockdown affected synaptogenesis and Ca(2) homeostasis in cultured rat hippocampal neurons
21485012 our results suggest that Rem2 regulates dendritic branching and synapse development
20231315 Rem2 mediates the fibroblastic growth factor 2 (FGF2) signaling pathway to maintain proliferation of hESCsby suppressing the transcriptional activity of p53 and cyclin D(1)
18056257 data unravel a possible molecular mechanism for Rem2-induced angiogenesis and suggests Rem2 as a potential novel target for treating pathological angiogenesis
15728182 inhibition of L-type Ca2+ channels by Rem2 signaling may represent a new and potentially important mechanism for regulating Ca2+-triggered exocytosis in hormone-secreting cells, including insulin secretion in pancreatic beta-cells

AA Sequence

MHTDLDTDMDMDTETTALCPSGSRRASPPGTPTPEADATLLKKSEKLLAELDRSGLPSAPGAPRRRGSMP      1 - 70
VPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSGEAAPAQKDGIFKVMLVGESGVGKSTLAGTFGGLQGD     71 - 140
SAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETL    141 - 210
LRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLR    211 - 280
RGRNHAGGQRPDPGSPEGPAPPARRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL              281 - 340
//

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
23991227 2013 A loss-of-function analysis reveals that endogenous Rem2 promotes functional glutamatergic synapse formation and restricts dendritic complexity.
22815963 2012 Activity-dependent subcellular cotrafficking of the small GTPase Rem2 and Ca2+/CaM-dependent protein kinase II?.
21980534 2011 Rem2-targeted shRNAs reduce frequency of miniature excitatory postsynaptic currents without altering voltage-gated Ca²? currents.
21485012 2011 The GTPase Rem2 regulates synapse development and dendritic morphology.
20231315 2010 Rem2 GTPase maintains survival of human embryonic stem cells as well as enhancing reprogramming by regulating p53 and cyclin D1.
18056257 2008 An endothelial cell genetic screen identifies the GTPase Rem2 as a suppressor of p19ARF expression that promotes endothelial cell proliferation and angiogenesis.
15728182 2005 Regulation of L-type Ca2+ channel activity and insulin secretion by the Rem2 GTPase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...