Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.96
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 9.54748090522731E-20
posterior fossa group A ependymoma 1511 2.11860559655068E-16
atypical teratoid / rhabdoid tumor 4369 5.98882880861687E-8
ovarian cancer 8492 1.97541508753925E-7
glioblastoma 5572 4.56197242985624E-7
medulloblastoma 1524 7.98482986185806E-7
primitive neuroectodermal tumor 3031 1.22024072258441E-5
adult high grade glioma 2148 1.34534959944824E-5
cystic fibrosis 1670 2.02384950878462E-5
pituitary cancer 1972 4.52446923137346E-5
Pick disease 1893 1.71527295692795E-4
malignant mesothelioma 3163 1.78308505457186E-4
pilocytic astrocytoma 3086 1.89061113877859E-4
medulloblastoma, large-cell 6234 2.49641411971899E-4
interstitial cystitis 2299 3.3454238447766E-4
psoriasis 6685 0.00128020638229476
lung cancer 4473 0.00862580369307352
oligodendroglioma 2849 0.0211089130745617
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
oligodendroglioma 1.200 0.021
psoriasis -1.600 0.001
posterior fossa group A ependymoma -2.100 0.000
glioblastoma -2.100 0.000
medulloblastoma -2.100 0.000
cystic fibrosis -1.507 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -2.000 0.000
lung cancer -1.600 0.009
interstitial cystitis -1.200 0.000
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.200 0.000
lung adenocarcinoma -1.200 0.000
Pick disease -1.300 0.000
ovarian cancer -1.100 0.000
pituitary cancer 2.500 0.000

Synonym

Accession Q8IYK4 O60327 Q9BZR0
Symbols C1orf17
GLT25D2

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG

 GWAS Trait (1)

Gene RIF (7)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19075007 Two collagen beta(1-O)galactosyltransferases corresponding to the GLT25D1 and GLT25D2 proteins were identified.
8218172 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2649653 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2341393 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase
2283726 Addition of peripheral sugar residues such as galactose, N-acetylglucosamine, and sialic acid to HIV-1 gp120 is processed by specific glycosyltransferase

AA Sequence

MAARPAATLAWSLLLLSSALLREGCRARFVAERDSEDDGEEPVVFPESPLQSPTVLVAVLARNAAHTLPH      1 - 70
FLGCLERLDYPKSRMAIWAATDHNVDNTTEIFREWLKNVQRLYHYVEWRPMDEPESYPDEIGPKHWPTSR     71 - 140
FAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNLLIAENKTIVAPMLESRGLYSNFWCGITPKG    141 - 210
FYKRTPDYVQIREWKRTGCFPVPMVHSTFLIDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQ    211 - 280
MYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEIFMINLK    281 - 350
RRKDRRDRMLRTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV    351 - 420
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDNIDQAQLDWELIYIGRKRMQVKEPEKAVPNVANLVE    421 - 490
ADYSYWTLGYVISLEGAQKLVGANPFGKMLPVDEFLPVMYNKHPVAEYKEYYESRDLKAFSAEPLLIYPT    491 - 560
HYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSRIYSNAKNTEALPPPTSLDTVPSRDEL        561 - 626
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
21269460 2011 Initial characterization of the human central proteome.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
19075007 2009 Core glycosylation of collagen is initiated by two beta(1-O)galactosyltransferases.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...