Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.06
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.900 1.3e-05
Astrocytoma, Pilocytic -1.200 1.5e-04
atypical teratoid / rhabdoid tumor -2.200 6.0e-08
cystic fibrosis -1.507 2.0e-05
ependymoma -1.900 2.4e-14
glioblastoma -1.400 1.5e-04
group 4 medulloblastoma -1.900 1.8e-06
interstitial cystitis -1.200 3.3e-04
lung adenocarcinoma -1.200 9.5e-20
lung cancer -1.600 8.6e-03
malignant mesothelioma 1.300 1.8e-04
medulloblastoma, large-cell -1.900 2.5e-04
oligodendroglioma 1.200 2.1e-02
ovarian cancer -1.100 2.0e-07
Pick disease -1.300 1.7e-04
pituitary cancer 2.500 4.5e-05
primitive neuroectodermal tumor -2.000 1.2e-05
psoriasis -1.600 1.3e-03

Gene RIF (7)

AA Sequence

MAARPAATLAWSLLLLSSALLREGCRARFVAERDSEDDGEEPVVFPESPLQSPTVLVAVLARNAAHTLPH      1 - 70
FLGCLERLDYPKSRMAIWAATDHNVDNTTEIFREWLKNVQRLYHYVEWRPMDEPESYPDEIGPKHWPTSR     71 - 140
FAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNLLIAENKTIVAPMLESRGLYSNFWCGITPKG    141 - 210
FYKRTPDYVQIREWKRTGCFPVPMVHSTFLIDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQ    211 - 280
MYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEIFMINLK    281 - 350
RRKDRRDRMLRTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV    351 - 420
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDNIDQAQLDWELIYIGRKRMQVKEPEKAVPNVANLVE    421 - 490
ADYSYWTLGYVISLEGAQKLVGANPFGKMLPVDEFLPVMYNKHPVAEYKEYYESRDLKAFSAEPLLIYPT    491 - 560
HYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSRIYSNAKNTEALPPPTSLDTVPSRDEL        561 - 626
//

Text Mined References (14)

PMID Year Title