Property Summary

NCBI Gene PubMed Count 17
Grant Count 34
R01 Count 31
Funding $4,140,246.93
PubMed Score 11.47
PubTator Score 16.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -3.345 0.000
primary pancreatic ductal adenocarcinoma -1.456 0.001
tuberculosis 1.400 0.000
active ulcerative colitis 2.556 0.005
fibroadenoma 1.400 0.005
interstitial cystitis -1.600 0.001
lung adenocarcinoma 1.400 0.000
ductal carcinoma in situ 1.800 0.005
invasive ductal carcinoma 1.800 0.017
pancreatic cancer -1.500 0.001

Gene RIF (10)

PMID Text
25441765 High Expression of secretory leukocyte protease inhibitor is associated with metastasis in colorectal cancer.
24285265 SLPI regulation and activity is altered in the nasal mucosa of smokers.
23082202 Cdk2 also binds the N-terminal domain of Fbw7-gamma as well as SLP-1.
22438581 during exocytosis, actin depolymerization commences near the secretory organelle, not the plasma membrane, and secretory granules use a JFC1- and GMIP-dependent molecular mechanism to traverse cortical actin.
19528539 Slp1 inhibits dense granule secretion in platelets and that Rap1GAP2 modulates secretion by binding to Slp1.
18266782 These results suggest that both Slp1 and Slp2-a may form part of a docking complex, capturing secretory lysosomes at the immunological synapse.
17200145 Levels of mRNA and immunostaining of the antiproteases elafin and SLPI were enhanced strongly in inflamed versus noninflamed UC. Elafin and SLPI may be added to the list of defensin-like peptides with diminished induction in CD versus UC.
16004602 evidence that JFC1 differentially regulates the secretion of PSAP and PSA, and that Rab27a and PI3K play a central role in the exocytosis of prostate-specific markers
12137562 transcriptional activation of JFC1 by the TNFalpha/NF-kappaB pathway is significant in prostate carcinoma cell lines
11773082 Jfc1/synaptotagmin-like protein 1 (Slp1) contains an N-terminal Slp homology domain (SHD) (PMID: 11327731). The SHD of Slp1/Jfc1 specifically and directly binds the GTP-bound form of Rab27A (J. Biol. Chem. 277, (2002) 9212-9218; PMID: 11773082).

AA Sequence

MPQRGHPSQEGLWALPSLPMAHGPKPETEGLLDLSFLTEEEQEAIAGVLQRDARLRQLEEGRVSKLRASV      1 - 70
ADPGQLKILTGDWFQEARSQRHHNAHFGSDLVRASMRRKKSTRGDQAPGHDREAEAAVKEKEEGPEPRLT     71 - 140
IDEAPQERLRETEGPDFPSPSVPLKASDPEEASQAQEDPGQGDQQVCAEEADPELEPASGGEQEPRPQQA    141 - 210
QTKAASQILENGEEAPGPDPSLDRMLSSSSSVSSLNSSTLSGSQMSLSGDAEAVQVRGSVHFALHYEPGA    211 - 280
AELRVHVIQCQGLAAARRRRSDPYVKSYLLPDKQSKRKTAVKKRNLNPVFNETLRYSVPQAELQGRVLSL    281 - 350
SVWHRESLGRNIFLGEVEVPLDTWDWGSEPTWLPLQPRVPPSPDDLPSRGLLALSLKYVPAGSEGAGLPP    351 - 420
SGELHFWVKEARDLLPLRAGSLDTYVQCFVLPDDSQASRQRTRVVRRSLSPVFNHTMVYDGFGPADLRQA    421 - 490
CAELSLWDHGALANRQLGGTRLSLGTGSSYGLQVPWMDSTPEEKQLWQALLEQPCEWVDGLLPLRTNLAP    491 - 560
RT                                                                        561 - 562
//

Text Mined References (20)

PMID Year Title
25441765 2014 Expression of secretory leukocyte protease inhibitor detected by immunohistochemistry correlating with prognosis and metastasis in colorectal cancer.
24285265 2014 Regulation and activity of secretory leukoprotease inhibitor (SLPI) is altered in smokers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23082202 2012 The stomatin-like protein SLP-1 and Cdk2 interact with the F-Box protein Fbw7-?.
22438581 2012 Vesicular trafficking through cortical actin during exocytosis is regulated by the Rab27a effector JFC1/Slp1 and the RhoA-GTPase-activating protein Gem-interacting protein.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19528539 2009 Synaptotagmin-like protein 1 interacts with the GTPase-activating protein Rap1GAP2 and regulates dense granule secretion in platelets.
18266782 2008 Slp1 and Slp2-a localize to the plasma membrane of CTL and contribute to secretion from the immunological synapse.
17200145 2007 Attenuated induction of epithelial and leukocyte serine antiproteases elafin and secretory leukocyte protease inhibitor in Crohn's disease.
More...