Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.38
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.900 0.000
posterior fossa group B ependymoma 1.200 0.000
lung carcinoma -1.800 0.000
non-small cell lung carcinoma -1.600 0.000

Gene RIF (1)

PMID Text
18723019 Genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MMALVRDRRAHYVMSIVIRWVHCFSSSLRGTFGTRWEAMKAKATELRVCCARRKREAREFKPPQMRGSTR      1 - 70
LNISDDLKIGFFSTDHATQTDSSEILSVKELSSSTQKLAQMMKSLQVDFGFLKQLLQLKFEDRLKEESLS     71 - 140
LFTILHDRILEIEKHYQQNEDKMRKSFNQQLADAIAVIKGMYQQFFEVEEENVSLQDASTVKTNILLRKL    141 - 210
KEKEEVIKELKEELDQYKDFGFHKMESFAKETSSPKSNLEKENLEYKVENERLLQIISELEEEIQINLKE    211 - 280
NSGLEDELISMKEMAEKDHKTIQKLMDSRDRLREELHYEKSLVQDVINKQKEDKEMRKKYGSLSVKVARS    281 - 350
AKGREASLSPWPKSPPSTTALRPHSATMSVSSAGAQKAKMPKKALKEDQAVVEDKHGLESQIEALKANLE    351 - 420
NEKKKVERFRKEADRLNKSWEKRFFILRNSFHVLKNEMFTRHTLFRQFAVLADTSFNYIKVKPLLVQSRT    421 - 490
TMTAISSSSHCTSSIDGKHVDVVSDQAALQLSPKGKLSESPKEESLEEPSMRQSSPAETVD             491 - 551
//

Text Mined References (7)

PMID Year Title
27812135 2016 Characterization and Genetic Analyses of New Genes Coding for NOD2 Interacting Proteins.
18723019 2008 Genome-wide association analysis in sarcoidosis and Crohn's disease unravels a common susceptibility locus on 10p12.2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.