Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.400 4.9e-07
Astrocytoma, Pilocytic -2.400 6.8e-11
atypical teratoid / rhabdoid tumor -1.700 1.8e-03
ependymoma -2.400 4.3e-23
glioblastoma -2.200 7.1e-12
group 3 medulloblastoma -1.300 1.2e-02
medulloblastoma, large-cell -1.400 3.9e-03
primitive neuroectodermal tumor -2.100 3.3e-06
psoriasis -2.400 3.8e-52
subependymal giant cell astrocytoma -1.463 2.0e-02

Gene RIF (2)

AA Sequence

MSLGGASERSVPATKIEITVSCRNLLDLDTFSKSDPMVVLYTQSRASQEWREFGRTEVIDNTLNPDFVRK      1 - 70
FVLDYFFEEKQNLRFDVYNVDSKTNISKPKDFLGQAFLALGEVIGGQGSRVERTLTGVPGKKCGTILLTA     71 - 140
EELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRAL    141 - 210
CNGDYDRTVKIDVYDWDRDGSHDFIGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYVNSGTVTLLSF    211 - 280
SVDSEFTFVDYIKGGTQLNFTVAIDFTASNGNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLF    281 - 350
PAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKIS    351 - 420
DGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDI    421 - 490
VQFVPFRDYVDRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQPRPPPPANPSPIPAPEQP           491 - 553
//

Text Mined References (12)

PMID Year Title