Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
interstitial cystitis 2312 6.5e-04
intraductal papillary-mucinous adenoma (IPMA) 2955 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.600 6.5e-04
intraductal papillary-mucinous adenoma (... 1.100 1.9e-03

Gene RIF (1)

AA Sequence

MDPVAFKDVAVNFTQEEWALLDISQRKLYREVMLETFRNLTSLGKRWKDQNIEYEHQNPRRNFRSLIEEK      1 - 70
VNEIKDDSHCGETFTPVPDDRLNFQEKKASPEVKSCESFVCGEVGLGNSSFNMNIRGDIGHKAYEYQEYG     71 - 140
PKPCKCQQPKKAFRYRPSFRTQERDHTGEKPNACKVCGKTFISHSSVRRHMVMHSGDGPYKCKFCGKAFH    141 - 210
CLRLYLIHERIHTGEKPCECKQCGKSFSYSATHRIHKRTHTGEKPYEYQECGKAFHSPRSYRRHERIHMG    211 - 280
EKAYQCKECGKAFTCPRYVRIHERTHSRKNLYECKQCGKALSSLTSFQTHVRLHSGERPYECKICGKDFC    281 - 350
SVNSFQRHEKIHSGEKPYKCKQCGKAFPHSSSLRYHERTHTGEKPYECKQCGKAFRSASHLRVHGRTHTG    351 - 420
EKPYECKECGKAFRYVNNLQSHERTQTHIRIHSGERRYKCKICGKGFYCPKSFQRHEKTHTGEKLYECKQ    421 - 490
RSVVPSVVPVPFDIMKGLTLERSPINASNVGKPSELCQSFECMVGLTLKRNPMSVSNDGKPSDLPHTFEY    491 - 560
VVGHTMERSPMHVRNVGNPSDLPRTFEFMKGHKHT                                       561 - 595
//

Text Mined References (8)

PMID Year Title