Property Summary

NCBI Gene PubMed Count 22
PubMed Score 14.83
PubTator Score 7.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.500 2.6e-02
atypical teratoid / rhabdoid tumor -1.200 3.1e-03
Breast cancer 3.700 2.2e-02
intraductal papillary-mucinous adenoma (... 1.100 3.4e-02
medulloblastoma, large-cell -1.300 9.0e-04
ovarian cancer -1.500 7.5e-06

Synonym

Accession Q8IYI6 B3KU33 Q5TE82
Symbols EXO84
SEC84
Exo84p

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLKRNVYQNYRQF      1 - 70
IETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAAAAGAAAASGGEEGVGGAGGRDHLRGQAGFF     71 - 140
STPGGASRDGSGPGEEGKQRTLTTLLEKVEGCRHLLETPGQYLVYNGDLVEYDADHMAQLQRVHGFLMND    141 - 210
CLLVATWLPQRRGMYRYNALYSLDGLAVVNVKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEDT    211 - 280
KRALSEKRRREQEEAAAPRGPPQVTSKATNPFEDDEEEEPAVPEVEEEKVDLSMEWIQELPEDLDVCIAQ    281 - 350
RDFEGAVDLLDKLNHYLEDKPSPPPVKELRAKVEERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIR    351 - 420
LGQCTKACELFLRNRAAAVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFEIDFAGTDSGCYSAFV    421 - 490
VWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLDLTFIIHALLVKDIQGALHSYKE    491 - 560
IIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVSNFEQYTGDDCWVNLSYTVVAFTKQTMGFLEE    561 - 630
ALKLYFPELHMVLLESLVEIILVAVQHVDYSLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKP    631 - 700
AKQLQDLRNASRLIRVNPESTTSVV                                                 701 - 725
//

Text Mined References (26)

PMID Year Title