Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.6e-07
intraductal papillary-mucinous neoplasm (IPMN) 3291 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Atherosclerosis 291 0.0 1.1

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.500 2.4e-03
osteosarcoma -1.964 2.6e-07

AA Sequence

MAARDATSGSLSEESSALDLPSACDIRDYVLQGPSQEANSEAFSSLEFHSFPYSSDVDPDTSNLNIEQNN      1 - 70
SWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSASVCKCLSQKITQLRGQESQKY     71 - 140
ALRSFQMARVIFNRDGCSVLQRHSRDTHFYPLEEGSTSLDDEKPNPGLSKDITHFLLQQNVMKDL         141 - 205
//

Text Mined References (5)

PMID Year Title