Property Summary

NCBI Gene PubMed Count 11
Grant Count 9
R01 Count 9
Funding $2,094,099
PubMed Score 10.60
PubTator Score 6.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26136358 Genetic screening of a large cohort of idiopathic infertile men reveals that TEX11 mutations, including frameshift and splicing acceptor site mutations, cause infertility in 1% of azoospermic men.
26136358 TEX11 mutations, including frameshift and splicing acceptor site mutations, cause infertility in 1% of non-obstructive azoospermic men.
25970010 hemizygous TEX11 mutations were a common cause of meiotic arrest and azoospermia in infertile men
20378615 Observational study of gene-disease association. (HuGE Navigator)
11279525 TEX11 was specifically expressed in human testis.

AA Sequence

MISAHCNLRLLCSSDSSASASQVAGTTEVVENLVTNDNSPNIPEAIDRLFSDIANINRESMAEITDIQIE      1 - 70
EMAVNLWNWALTIGGGWLVNEEQKIRLHYVACKLLSMCEASFASEQSIQRLIMMNMRIGKEWLDAGNFLI     71 - 140
ADECFQAAVASLEQLYVKLIQRSSPEADLTMEKITVESDHFRVLSYQAESAVAQGDFQRASMCVLQCKDM    141 - 210
LMRLPQMTSSLHHLCYNFGVETQKNNKYEESSFWLSQSYDIGKMDKKSTGPEMLAKVLRLLATNYLDWDD    211 - 280
TKYYDKALNAVNLANKEHLSSPGLFLKMKILLKGETSNEELLEAVMEILHLDMPLDFCLNIAKLLMDHER    281 - 350
ESVGFHFLTIIHERFKSSENIGKVLILHTDMLLQRKEELLAKEKIEEIFLAHQTGRQLTAESMNWLHNIL    351 - 420
WRQAASSFEVQNYTDALQWYYYSLRFYSTDEMDLDFTKLQRNMACCYLNLQQLDKAKEAVAEAERHDPRN    421 - 490
VFTQFYIFKIAVIEGNSERALQAIITLENILTDEESEDNDLVAERGSPTMLLSLAAQFALENGQQIVAEK    491 - 560
ALEYLAQHSEDQEQVLTAVKCLLRFLLPKIAEMPESEDKKKEMDRLLTCLNRAFVKLSQPFGEEALSLES    561 - 630
RANEAQWFRKTAWNLAVQCDKDPVMMREFFILSYKMSQFCPSDQVILIARKTCLLMAVAVDLEQGRKAST    631 - 700
AFEQTMFLSRALEEIQTCNDIHNFLKQTGTFSNDSCEKLLLLYEFEVRAKLNDPLLESFLESVWELPHLE    701 - 770
TKTFETIAIIAMEKPAHYPLIALKALKKALLLYKKEEPIDISQYSKCMHNLVNLSVPDGASNVELCPLEE    771 - 840
VWGYFEDALSHISRTKDYPEMEILWLMVKSWNTGVLMFSRSKYASAEKWCGLALRFLNHLTSFKESYETQ    841 - 910
MNMLYSQLVEALSNNKGPVFHEHGYWSKSD                                            911 - 940
//

Text Mined References (14)

PMID Year Title
26136358 2015 TEX11 is mutated in infertile men with azoospermia and regulates genome-wide recombination rates in mouse.
25970010 2015 X-linked TEX11 mutations, meiotic arrest, and azoospermia in infertile men.
25416956 2014 A proteome-scale map of the human interactome network.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
18369460 2008 ZIP4H (TEX11) deficiency in the mouse impairs meiotic double strand break repair and the regulation of crossing over.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...