Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.77
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 7.8e-09
ovarian cancer 8520 2.6e-06
posterior fossa group B ependymoma 416 1.3e-05
ulcerative colitis 1819 6.1e-04
group 3 medulloblastoma 4104 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Ciliopathy 71 3.284 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.500 1.3e-03
osteosarcoma 2.438 7.8e-09
ovarian cancer 1.300 2.6e-06
posterior fossa group B ependymoma 1.200 1.3e-05
ulcerative colitis -1.100 6.1e-04

Gene RIF (1)

AA Sequence

MAADESSQNTLRLQFKAMQEMQHKRLQKQMEKKREKELSLKSRADDQEEPLEVSDGLSLLHAGEPNSKNS      1 - 70
FEKRVLEDEIEHLRNELRETVDENGRLYKLLKERDFEIKHLKKKIEEDRFAFTGTAGVAGDVVATKIVEL     71 - 140
SKKNRLLMAESEGAKTRVKQLTNRIQELERELQTALTRLSAKGATDAGAKPPRAQMGDRALLETPEVKAL    141 - 210
QDRLVATNLKMSDLRNQIQSVKQELRMAQKVLAREVGEDINVQQLLSSPGTWRGRAQQILVLQSKVQELE    211 - 280
KQLGQARSQSAGTASDELSVYPDPRKLSAQEKNLLRIRSLEREKQEGLEKLASERDVLQRELEELKKKFE    281 - 350
GMRSRNKLLSSEMKTLKSQMGTLVEKGRHDDELIDALMDQLKQLQEILGSLSLQEEKTRVSQHHLDQQLN    351 - 420
SEAQRSNSLVAQLQAMVAEREAKVRQLEMEIGQLNVHYLRNKGVGEGSSGREVSPAYTQFLEDPGLTKSP    421 - 490
ASAGDHVGRLGSSRSVTSLGHTLVESALTRPSLPSPHRTSPRFSDSPEQKGWQAQVSEIKALWQAAEVER    491 - 560
DRLTEFVTVLQKRVEESNSKLLESERKLQEERHRTVVLEQHLEKIRLEPGKASASQRAAPRTKTGLPTSN    561 - 630
NRHNPTGSEKKDPSFAQLSDVPVESQMEELTTRLAIQVEENEMLKAALGSALRGKEEDFRMYHEILGQVK    631 - 700
SVFLQALRQQKTGKQ                                                           701 - 715
//

Text Mined References (9)

PMID Year Title