Property Summary

NCBI Gene PubMed Count 41
Grant Count 22
R01 Count 18
Funding $2,185,506.24
PubMed Score 51.67
PubTator Score 43.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.505 0.004
tuberculosis -1.400 0.000
group 3 medulloblastoma 1.400 0.000
ovarian cancer -1.100 0.000
pituitary cancer 1.200 0.000

Gene RIF (34)

PMID Text
26130695 we provide evidence for the first time showing that the common p.Arg1931* loss-of-function variant in FANCM is a risk factor for familial breast cancer.
26067930 FANCM c.5101C>T mutation was not identified in Pakistani triple-negative breast cancer patients
25288723 FANCM is a breast cancer susceptibility gene, mutations in which confer a particularly strong predisposition for triple-negative breast cancer
24699063 The MHF complex, which is a heterotetramer that comprises two MHF1-MHF2 heterodimers, is remodeled by FANCM to favor recognition of branched DNA over dsDNA.
24390579 MHF facilitates the processing of multiple types of branched DNAs by the DNA translocase FANCM. MHF complex recognizes branched DNA and stimulates FANCM activity at such a structure to promote genome maintenance.
24207054 The traverse frequency was strongly reduced by inactivation of the translocase and DNA binding activities of the FANCM/MHF complex.
24003026 Variations of several key residues and the electrostatic property at the active-site region render a catalytically inactive nuclease domain of FANCM, accounting for the lack of nuclease activity.
23932590 The FANCM translocase domain lies in proximity to C-terminal domain and binding fork DNA structures stimulate its ATPase activity.
23698467 Genotoxic stress-induced FANCM phosphorylation is ATR-dependent.
23333308 FANCM participates in recombination-independent interstrand crosslink repair by facilitating recruitment of lesion incision activities, which requires its translocase activity
More...

AA Sequence

MSGRQRTLFQTWGSSISRSSGTPGCSSGTERPQSPGSSKAPLPAAAEAQLESDDDVLLVAAYEAERQLCL      1 - 70
ENGGFCTSAGALWIYPTNCPVRDYQLHISRAALFCNTLVCLPTGLGKTFIAAVVMYNFYRWFPSGKVVFM     71 - 140
APTKPLVTQQIEACYQVMGIPQSHMAEMTGSTQASTRKEIWCSKRVLFLTPQVMVNDLSRGACPAAEIKC    141 - 210
LVIDEAHKALGNYAYCQVVRELVKYTNHFRILALSATPGSDIKAVQQVITNLLIGQIELRSEDSPDILTY    211 - 280
SHERKVEKLIVPLGEELAAIQKTYIQILESFARSLIQRNVLMRRDIPNLTKYQIILARDQFRKNPSPNIV    281 - 350
GIQQGIIEGEFAICISLYHGYELLQQMGMRSLYFFLCGIMDGTKGMTRSKNELGRNEDFMKLYNHLECMF    351 - 420
ARTRSTSANGISAIQQGDKNKKFVYSHPKLKKLEEVVIEHFKSWNAENTTEKKRDETRVMIFSSFRDSVQ    421 - 490
EIAEMLSQHQPIIRVMTFVGHASGKSTKGFTQKEQLEVVKQFRDGGYNTLVSTCVGEEGLDIGEVDLIIC    491 - 560
FDSQKSPIRLVQRMGRTGRKRQGRIVIILSEGREERIYNQSQSNKRSIYKAISSNRQVLHFYQRSPRMVP    561 - 630
DGINPKLHKMFITHGVYEPEKPSRNLQRKSSIFSYRDGMRQSSLKKDWFLSEEEFKLWNRLYRLRDSDEI    631 - 700
KEITLPQVQFSSLQNEENKPAQESTTGIHQLSLSEWRLWQDHPLPTHQVDHSDRCRHFIGLMQMIEGMRH    701 - 770
EEGECSYELEVESYLQMEDVTSTFIAPRNESNNLASDTFITHKKSSFIKNINQGSSSSVIESDEECAEIV    771 - 840
KQTHIKPTKIVSLKKKVSKEIKKDQLKKENNHGIIDSVDNDRNSTVENIFQEDLPNDKRTSDTDEIAATC    841 - 910
TINENVIKEPCVLLTECQFTNKSTSSLAGNVLDSGYNSFNDEKSVSSNLFLPFEEELYIVRTDDQFYNCH    911 - 980
SLTKEVLANVERFLSYSPPPLSGLSDLEYEIAKGTALENLLFLPCAEHLRSDKCTCLLSHSAVNSQQNLE    981 - 1050
LNSLKCINYPSEKSCLYDIPNDNISDEPSLCDCDVHKHNQNENLVPNNRVQIHRSPAQNLVGENNHDVDN   1051 - 1120
SDLPVLSTDQDESLLLFEDVNTEFDDVSLSPLNSKSESLPVSDKTAISETPLVSQFLISDELLLDNNSEL   1121 - 1190
QDQITRDANSFKSRDQRGVQEEKVKNHEDIFDCSRDLFSVTFDLGFCSPDSDDEILEHTSDSNRPLDDLY   1191 - 1260
GRYLEIKEISDANYVSNQALIPRDHSKNFTSGTVIIPSNEDMQNPNYVHLPLSAAKNEELLSPGYSQFSL   1261 - 1330
PVQKKVMSTPLSKSNTLNSFSKIRKEILKTPDSSKEKVNLQRFKEALNSTFDYSEFSLEKSKSSGPMYLH   1331 - 1400
KSCHSVEDGQLLTSNESEDDEIFRRKVKRAKGNVLNSPEDQKNSEVDSPLHAVKKRRFPINRSELSSSDE   1401 - 1470
SENFPKPCSQLEDFKVCNGNARRGIKVPKRQSHLKHVARKFLDDEAELSEEDAEYVSSDENDESENEQDS   1471 - 1540
SLLDFLNDETQLSQAINDSEMRAIYMKSLRSPMMNNKYKMIHKTHKNINIFSQIPEQDETYLEDSFCVDE   1541 - 1610
EESCKGQSSEEEVCVDFNLITDDCFANSKKYKTRRAVMLKEMMEQNCAHSKKKLSRIILPDDSSEEENNV   1611 - 1680
NDKRESNIAVNPSTVKKNKQQDHCLNSVPSGSSAQSKVRSTPRVNPLAKQSKQTSLNLKDTISEVSDFKP   1681 - 1750
QNHNEVQSTTPPFTTVDSQKDCRKFPVPQKDGSALEDSSTSGASCSKSRPHLAGTHTSLRLPQEGKGTCI   1751 - 1820
LVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNSVNKNKFIEQIQHLQSM   1821 - 1890
FERICVIVEKDREKTGDTSRMFRRTKSYDSLLTTLIGAGIRILFSSCQEETADLLKELSLVEQRKNVGIH   1891 - 1960
VPTVVNSNKSEALQFYLSIPNISYITALNMCHQFSSVKRMANSSLQEISMYAQVTHQKAEEIYRYIHYVF   1961 - 2030
DIQMLPNDLNQDRLKSDI                                                       2031 - 2048
//

Text Mined References (42)

PMID Year Title
26130695 2015 FANCM c.5791C>T nonsense mutation (rs144567652) induces exon skipping, affects DNA repair activity and is a familial breast cancer risk factor.
26067930 2015 Absence of the FANCM c.5101C>T mutation in BRCA1/2-negative triple-negative breast cancer patients from Pakistan.
25416956 2014 A proteome-scale map of the human interactome network.
25288723 2014 Exome sequencing identifies FANCM as a susceptibility gene for triple-negative breast cancer.
24699063 2014 The histone-fold complex MHF is remodeled by FANCM to recognize branched DNA and protect genome stability.
24390579 2014 The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
24207054 2013 The DNA translocase FANCM/MHF promotes replication traverse of DNA interstrand crosslinks.
24003026 2013 Structural insights into the functions of the FANCM-FAAP24 complex in DNA repair.
23932590 2013 Architecture and DNA recognition elements of the Fanconi anemia FANCM-FAAP24 complex.
23698467 2013 ATR-dependent phosphorylation of FANCM at serine 1045 is essential for FANCM functions.
More...