Property Summary

NCBI Gene PubMed Count 20
Grant Count 9
R01 Count 7
Funding $922,228.8
PubMed Score 6.76
PubTator Score 10.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
psoriasis -1.400 0.000
medulloblastoma, large-cell -1.400 0.000
intraductal papillary-mucinous carcinoma... -2.300 0.029
breast carcinoma -1.100 0.000
Breast cancer -2.500 0.000
ovarian cancer -2.000 0.000

Gene RIF (5)

PMID Text
24569073 The proteolytic cleavage of eRF3a and eRF3b into p-eRF3 leads to release an amino-terminal fragment containing nuclear export signal to allow the relocalization of eRF3 into the nucleus to interact with the p14ARF.
24466059 The tumor marker eRF3B can change the cell cycle and influence the phosphorylation status of 4E-BP1.
23377885 The survivin and eRF3 complex may function in spindle formation and segregation of chromosomes and cytokinesis.
19417105 eRF1's M domain contacts eRF3's GTPase domain
15987998 eRF3b can substitute for eRF3a in its translation termination function.

AA Sequence

MDSGSSSSDSAPDCWDQVDMESPGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFVPNVHAAEFVP      1 - 70
SFLRGPTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENG     71 - 140
EVEMALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPKKEHVNVVFIG    141 - 210
HVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETER    211 - 280
KHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINK    281 - 350
MDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTGLPFIPYLDNL    351 - 420
PNFNRSIDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGEN    421 - 490
LKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALISL    491 - 560
VDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD      561 - 628
//

Text Mined References (27)

PMID Year Title
24569073 2014 The processed isoform of the translation termination factor eRF3 localizes to the nucleus to interact with the ARF tumor suppressor.
24466059 2014 eRF3b, a biomarker for hepatocellular carcinoma, influences cell cycle and phosphoralation status of 4E-BP1.
23377885 2013 Polypeptide chain release factor eRF3 is a novel molecular partner of survivin.
23340509 2013 Phosphorylation at intrinsically disordered regions of PAM2 motif-containing proteins modulates their interactions with PABPC1 and influences mRNA fate.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19417105 2009 Structural insights into eRF3 and stop codon recognition by eRF1.
19417104 2009 SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay.
18447585 2008 A competition between stimulators and antagonists of Upf complex recruitment governs human nonsense-mediated mRNA decay.
More...