Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Gastric adenocarcinoma 2 3.077 1.5

AA Sequence

MELVTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLVSLGFVISNPDLVTCLEQIKEPCNLKIHET      1 - 70
AAKPPAICSPFSQDLSPVQGIEDSFHKLILKRYEKCGHENLQLRKGCKRVNECKVQKGVNNGVYQCLSTT     71 - 140
QSKIFQCNTCVKVFSKFSNSNKHKIRHTGEKPFKCTECGRSFYMSHLTQHTGIHAGEKPYKCEKCGKAFN    141 - 210
RSTSLSKHKRIHTGEKPYTCEECGKAFRRSTVLNEHKKIHTGEKPYKCEECGKAFTRSTTLNEHKKIHTG    211 - 280
EKPYKCKECGKAFRWSTSMNEHKNIHTGEKPYKCKECGKAFRQSRSLNEHKNIHTGEKPYTCEKCGKAFN    281 - 350
QSSSLIIHRSIHSEQKLYKCEECGKAFTWSSSLNKHKRIHTGEKPYACEECGKAFYRSSHLAKHKRIHTG    351 - 420
EKPYTCEECGKAFNQSSTLILHKRIHSGQKPYKCEECGKAFTRSTTLNEHKKIHTGEKPYKCEECGKAFI    421 - 490
WSASLNEHKNIHTGEKPYKCKECGKAFNQSSGLIIHRSIHSEQKLYKCEECGKAFTRSTALNEHKKIHSG    491 - 560
EKPYKCKECGKAYNLSSTLTKHKRIHTGEKPFTCEECGKAFNWSSSLTKHKIIHTGEKSYKCEECGKAFN    561 - 630
RPSTLTVHKRIHTGKEHS                                                        631 - 648
//

Text Mined References (6)

PMID Year Title
22803940 2012 Cys2His2 zinc finger protein family: classification, functions, and major members.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2114117 1990 Zinc finger domains: hypotheses and current knowledge.