Property Summary

NCBI Gene PubMed Count 26
PubMed Score 57.63
PubTator Score 31.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Alopecia 115 0.0 0.0
Ichthyosis 56 0.0 0.0
Sarcopenia 1 0.0 0.0
Skin Abnormalities 37 0.0 0.0
Disease Target Count
Ichthyoses 41
Disease Target Count P-value
osteosarcoma 7950 4.0e-06
psoriasis 6694 2.6e-05
ovarian cancer 8520 1.4e-03
lung cancer 4740 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.100 4.2e-02
osteosarcoma -1.858 4.0e-06
ovarian cancer 1.200 1.4e-03
psoriasis -2.500 2.6e-05

Protein-protein Interaction (7)

Gene RIF (16)

AA Sequence

MSFSRALLWARLPAGRQAGHRAAICSALRPHFGPFPGVLGQVSVLATASSSASGGSKIPNTSLFVPLTVK      1 - 70
PQGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFHQAFISFRNYIMQSHSLDVD     71 - 140
IHIVLNDICFGAAHADDLFPFFLRHAKQIFPVLDCKDDLRKISDLRIPPNWYPDARAMQRKIIFHSGPTN    141 - 210
SGKTYHAIQKYFSAKSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCS    211 - 280
VTTPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTP    281 - 350
ISVLDHALESLDNLRPGDCIVCFSKNDIYSVSRQIEIRGLESAVIYGSLPPGTKLAQAKKFNDPNDPCKI    351 - 420
LVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHED    421 - 490
LSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIFVDFSQVDGQYFVCNMDDFKFSAEL    491 - 560
IQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEA    561 - 630
VHDVLDLYLWLSYRFMDMFPDASLIRDLQKELDGIIQDGVHNITKLIKMSETHKLLNLEGFPSGSQSRLS    631 - 700
GTLKSQARRTRGTKALGSKATEPPSPDAGELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESG    701 - 770
THPKGTRRKKKEPDSD                                                          771 - 786
//

Text Mined References (37)

PMID Year Title