Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.75
PubTator Score 6.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 1.0e-04
ovarian cancer 8520 3.0e-03
Multiple myeloma 1332 3.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Retinitis pigmentosa 25 9 5.409 2.7
Fundus dystrophy 83 3.088 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 1.0e-04
Multiple myeloma 1.160 3.6e-03
ovarian cancer 1.700 3.0e-03

Gene RIF (5)

AA Sequence

MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRV      1 - 70
KSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNIS     71 - 140
SSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKK    141 - 210
AAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSG    211 - 280
DLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVP    281 - 350
AAPGLIGNVMGQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWS    351 - 420
LSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWK                           421 - 467
//

Text Mined References (17)

PMID Year Title