Property Summary

NCBI Gene PubMed Count 19
PubMed Score 39.12
PubTator Score 20.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.000 4.7e-03
astrocytic glioma -2.200 3.6e-03
Astrocytoma, Pilocytic -2.500 5.1e-06
atypical teratoid / rhabdoid tumor -3.400 5.4e-09
ependymoma -1.600 1.4e-03
glioblastoma -2.300 2.7e-07
intraductal papillary-mucinous adenoma (... -1.700 2.4e-04
intraductal papillary-mucinous carcinoma... -1.800 2.2e-04
intraductal papillary-mucinous neoplasm ... -1.900 2.7e-03
lung cancer -1.600 3.2e-02
lung carcinoma 1.800 3.1e-14
malignant mesothelioma -4.400 1.1e-07
medulloblastoma -1.500 2.7e-02
medulloblastoma, large-cell -2.000 1.3e-02
oligodendroglioma -1.300 5.7e-03
ovarian cancer -1.700 8.6e-13
Pick disease -1.200 1.5e-02
primitive neuroectodermal tumor -3.800 1.9e-05
psoriasis -1.600 3.0e-25
subependymal giant cell astrocytoma -1.880 1.9e-03

Gene RIF (10)

AA Sequence

MYQGHMQKSKEQGYGKLSSDEDLEIIVDQKQGKGSRAADKAVAMVMKEIPREESAEEKPLLTMTSQLVNE      1 - 70
QQESRPLLSPSIDDFLCETKSEAIARPVTSNTAVLTTGLDLLDLSEPVSQTQTKAKKSEPSSKTSSLKKK     71 - 140
ADGSDLISTDAEQRGQPLRVPETSSLDLDIQTQLEKWDDVKFHGDRNTKGHPMAERKSSSSRTGSKELLW    141 - 210
SSEHRSQPELSGGKSALNSESASELELVAPTQARLTKEHRWGSALLSRNHSLEEEFERAKAAVESDTEFW    211 - 280
DKMQAEWEEMARRNWISENQEAQNQVTISASEKGYYFHTENPFKDWPGAFEEGLKRLKEGDLPVTILFME    281 - 350
AAILQDPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNW    351 - 420
IKQNPKYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEF    421 - 490
NRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYRE    491 - 560
AVSNFLTALSLQRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRAFNLDP        561 - 626
//

Text Mined References (22)

PMID Year Title