Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 1.5e-08
tuberculosis 2010 2.5e-05
ovarian cancer 8520 1.2e-04
glioblastoma 5792 3.1e-04
group 4 medulloblastoma 1855 2.1e-03
subependymal giant cell astrocytoma 2287 5.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.300 1.5e-08
glioblastoma -1.200 3.1e-04
group 4 medulloblastoma 1.100 2.1e-03
ovarian cancer -1.100 1.2e-04
subependymal giant cell astrocytoma -1.785 5.4e-03
tuberculosis -1.700 2.5e-05

Synonym

Accession Q8IYB1 Q86VD8
Symbols C3orf59

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MKMAAPTANKAASLGCNNKPAFPELDFRSGARVEELNKLIQEFTKHDQREYDDQRALEIHTAKDFIFSML      1 - 70
GMVQKLDQKLPVANEYLLLSGGVREGVVDLDLDELNVYARGTDYDMDFTLLVPALKLHDRNQPVTLDMRH     71 - 140
SALCHSWLSLRLFDEGTISKWKDCCTIVDHINGATNYFFSPTKVADWFYDSISIVLSEIQKKPQRGMPKV    141 - 210
EKVEKNGTIISIILGVGSSRMLYDIVPVVSFKGWPAVAQSWLMENHFWDGKITEEEVISGFYLVPACSYK    211 - 280
GKKDNEWRLSFARSEVQLKKCISSSLMQAYQACKAIIIKLLSRPKAISPYHLRSMMLWACDRLPANYLAQ    281 - 350
EDYAAHFLLGLIDDLQHCLVNKMCPNYFIPQCNMLEHLSEETVMLHARKLSSVRSDPAEHLRTAIEHVKA    351 - 420
ANRLTLELQRRGSTTSIPSPQSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF    421 - 490
F//

Text Mined References (8)

PMID Year Title