Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8IYB0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPSGEERRDRQKGRRAGCDTSSTPSNTAPRIPEPGAHPTAARPATAQPPRSLLPPVCSKTIALPASAAAA      1 - 70
SGSDTAGMRGLGKAPHSGEGHERGRGNSKMKACNNYQYGYLAKPDTSFWIKCRRWLLADAGRHTQRPFWT     71 - 140
FRVSHSPLLEAEAGRPSDVSQLQLGSDLKPKMRRPAGELFSPKDAGWELDPAEKSE                  141 - 196
//

Text Mined References (4)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.