Property Summary

NCBI Gene PubMed Count 15
Grant Count 7
R01 Count 7
Funding $1,243,787.5
PubMed Score 23.29
PubTator Score 8.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -3.000 0.000
posterior fossa group B ependymoma 2.400 0.000
medulloblastoma -2.800 0.001
medulloblastoma, large-cell -2.200 0.019
primitive neuroectodermal tumor -2.700 0.000
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -2.000 0.000
pituitary cancer -3.400 0.000

Gene RIF (5)

PMID Text
25332192 these data shed light on previously unrecognized roles of Mkx in tendinopathy, tenogenesis, and tendon repair as well as in regulating the TGFbeta pathway.
25312837 Transcription factor Mohawk controls tenogenic differentiation of bone marrow mesenchymal stem cells in vitro and in vivo.
23686683 Reduced expression of MKX is a feature of degenerated anterior cruciate ligament in osteoarthritis-affected joints.
20634891 Observational study of gene-disease association. (HuGE Navigator)
16077953 In silico characterization of the C10orf48 sequence

AA Sequence

MNTIVFNKLSGAVLFEDGGASERERGGRPYSGVLDSPHARPEVGIPDGPPLKDNLGLRHRRTGARQNGGK      1 - 70
VRHKRQALQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWA     71 - 140
LRIKLYNKYVQGNAERLSVSSDDSCSEDGENPPRTHMNEGGYNTPVHHPVIKSENSVIKAGVRPESRASE    141 - 210
DYVAPPKYKSSLLNRYLNDSLRHVMATNTTMMGKTRQRNHSGSFSSNEFEEELVSPSSSETEGNFVYRTD    211 - 280
TLENGSNKGESAANRKGPSKDDTYWKEINAAMALTNLAQGKDKLQGTTSCIIQKSSHIAEVKTVKVPLVQ    281 - 350
QF                                                                        351 - 352
//

Text Mined References (17)

PMID Year Title
25332192 2015 Mohawk promotes the tenogenesis of mesenchymal stem cells through activation of the TGF? signaling pathway.
25312837 2015 Transcription factor Mohawk controls tenogenic differentiation of bone marrow mesenchymal stem cells in vitro and in vivo.
23686683 2013 Transcription factor Mohawk and the pathogenesis of human anterior cruciate ligament degradation.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
20696843 2010 The atypical homeodomain transcription factor Mohawk controls tendon morphogenesis.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20498044 2010 The Mohawk homeobox gene is a critical regulator of tendon differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16408284 2006 Mohawk is a novel homeobox gene expressed in the developing mouse embryo.
More...