Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.98
PubTator Score 4.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.600 4.1e-05
atypical teratoid / rhabdoid tumor 2.500 1.5e-09
Breast cancer 1.100 1.6e-09
ependymoma 1.200 2.4e-05
glioblastoma 2.300 8.8e-09
group 3 medulloblastoma 3.300 1.2e-07
intraductal papillary-mucinous neoplasm ... 1.100 6.5e-03
lung adenocarcinoma 1.100 2.7e-07
medulloblastoma, large-cell 3.000 1.2e-07
non-small cell lung cancer 1.393 2.4e-20
ovarian cancer 1.200 1.7e-07
primitive neuroectodermal tumor 2.800 1.4e-05
psoriasis 1.500 1.7e-79

Gene RIF (4)

AA Sequence

MVGPGPTAAAAVEERQRKLQEYLAAKGKLKSQNTKPYLKSKNNCQNQPPSKSTIRPKNDVTNHVVLPVKP      1 - 70
KRSISIKLQPRPPNTAGSQKPKLEPPKLLGKRLTSECVSSNPYSKPSSKSFQQCEAGSSTTGELSRKPVG     71 - 140
SLNIEQLKTTKQQLTDQGNGKCIDFMNNIHVENESLDNFLKETNKENLLDILTEPERKPDPKLYTRSKPK    141 - 210
TDSYNQTKNSLVPKQALGKSSVNSAVLKDRVNKQFVGETQSRTFPVKSQQLSRGADLARPGVKPSRTVPS    211 - 280
HFIRTLSKVQSSKKPVVKNIKDIKVNRSQYERPNETKIRSYPVTEQRVKHTKPRTYPSLLQGEYNNRHPN    281 - 350
IKQDQKSSQVCIPQTSCVLQKSKAISQRPNLTVGRFNSAIPSTPSIRPNGTSGNKHNNNGFQQKAQTLDS    351 - 420
KLKKAVPQNHFLNKTAPKTQADVTTVNGTQTNPNIKKKATAEDRRKQLEEWQKSKGKTYKRPPMELKTKR    421 - 490
KVIKEMNISFWKSIEKEEEEKKAQLELSSKINNTLTECLNLIEGGVPSNEILNILSSIPEAEKFAKFWIC    491 - 560
KAKLLASKGTFDVIGLYEEAIKNGATPIQELRKVVLNILQDSNRTTEGITSDSLVAETSITSVEELAKKM    561 - 630
ESVKSCLSPKEREQVTATPRIAKAEQHNYPGIKLQIGPIPRINGMPEVQDMKFITPVRRSSRIERAVSRY    631 - 700
PEMLQEHDLVVASLDELLEVEETKCFIFRRNEALPVTLGFQTPES                             701 - 745
//

Text Mined References (16)

PMID Year Title