Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.98
PubTator Score 4.21

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25439729 Loss-of-function mutations in CKAP2L are a major cause of Filippi syndrome.
24260314 Radmis, the mouse ortholog of human CKAP2L, is important to mitotic spindle formation and cell-cycle progression of neural stem/neural progenitor cells in mouse. It is abundantly expressed in stem cells, but is down-regulated during differentiation.
20468071 Observational study of gene-disease association. (HuGE Navigator)
18723088 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVGPGPTAAAAVEERQRKLQEYLAAKGKLKSQNTKPYLKSKNNCQNQPPSKSTIRPKNDVTNHVVLPVKP      1 - 70
KRSISIKLQPRPPNTAGSQKPKLEPPKLLGKRLTSECVSSNPYSKPSSKSFQQCEAGSSTTGELSRKPVG     71 - 140
SLNIEQLKTTKQQLTDQGNGKCIDFMNNIHVENESLDNFLKETNKENLLDILTEPERKPDPKLYTRSKPK    141 - 210
TDSYNQTKNSLVPKQALGKSSVNSAVLKDRVNKQFVGETQSRTFPVKSQQLSRGADLARPGVKPSRTVPS    211 - 280
HFIRTLSKVQSSKKPVVKNIKDIKVNRSQYERPNETKIRSYPVTEQRVKHTKPRTYPSLLQGEYNNRHPN    281 - 350
IKQDQKSSQVCIPQTSCVLQKSKAISQRPNLTVGRFNSAIPSTPSIRPNGTSGNKHNNNGFQQKAQTLDS    351 - 420
KLKKAVPQNHFLNKTAPKTQADVTTVNGTQTNPNIKKKATAEDRRKQLEEWQKSKGKTYKRPPMELKTKR    421 - 490
KVIKEMNISFWKSIEKEEEEKKAQLELSSKINNTLTECLNLIEGGVPSNEILNILSSIPEAEKFAKFWIC    491 - 560
KAKLLASKGTFDVIGLYEEAIKNGATPIQELRKVVLNILQDSNRTTEGITSDSLVAETSITSVEELAKKM    561 - 630
ESVKSCLSPKEREQVTATPRIAKAEQHNYPGIKLQIGPIPRINGMPEVQDMKFITPVRRSSRIERAVSRY    631 - 700
PEMLQEHDLVVASLDELLEVEETKCFIFRRNEALPVTLGFQTPES                             701 - 745
//

Text Mined References (15)

PMID Year Title
25439729 2014 Mutations in CKAP2L, the human homolog of the mouse Radmis gene, cause Filippi syndrome.
24260314 2013 Radmis, a novel mitotic spindle protein that functions in cell division of neural progenitors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
20388717 2010 In vivo identification of sumoylation sites by a signature tag and cysteine-targeted affinity purification.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18723088 2008 Polymorphisms in the interleukin-1 (IL1) gene cluster are not associated with aggressive periodontitis in a large Caucasian population.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...