Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.94
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q8IY95 Q7Z3A1 Q8N928
Symbols

Gene

Gene RIF (3)

PMID Text
22736246 TMEM192 deficiency can induce autophagy in tumor cells, and can further activate apoptosis by the mitochondrial pathway through autophagy.
22190034 HIV-1 Vpu is identified to have a physical interaction with transmembrane protein 192 (TMEM192) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20370317 TMEM192 was found to be strongly expressed in human kidney, liver, lung and pancreas tissue. The widespread tissue distribution could suggest an important role of TMEM192 for lysosomal function.

AA Sequence

MAAGGRMEDGSLDITQSIEDDPLLDAQLLPHHSLQAHFRPRFHPLPTVIIVNLLWFIHLVFVVLAFLTGV      1 - 70
LCSYPNPNEDKCPGNYTNPLKVQTVIILGKVILWILHLLLECYIQYHHSKIRNRGYNLIYRSTRHLKRLA     71 - 140
LMIQSSGNTVLLLILCMQHSFPEPGRLYLDLILAILALELICSLICLLIYTVKIRRFNKAKPEPDILEEE    141 - 210
KIYAYPSNITSETGFRTISSLEEIVEKQGDTIEYLKRHNALLSKRLLALTSSDLGCQPSRT             211 - 271
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22736246 2012 Lysosomal membrane protein TMEM192 deficiency triggers crosstalk between autophagy and apoptosis in HepG2 hepatoma cells.
21269460 2011 Initial characterization of the human central proteome.
20370317 2010 Molecular characterisation of 'transmembrane protein 192' (TMEM192), a novel protein of the lysosomal membrane.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897319 2007 Integral and associated lysosomal membrane proteins.
More...