Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.04
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.100 6.2e-03
intraductal papillary-mucinous carcinoma... -1.600 2.8e-03
osteosarcoma 2.586 6.6e-07
ovarian cancer -1.200 2.7e-05
ulcerative colitis -1.300 1.2e-06

Gene RIF (4)

AA Sequence

MAAGGRMEDGSLDITQSIEDDPLLDAQLLPHHSLQAHFRPRFHPLPTVIIVNLLWFIHLVFVVLAFLTGV      1 - 70
LCSYPNPNEDKCPGNYTNPLKVQTVIILGKVILWILHLLLECYIQYHHSKIRNRGYNLIYRSTRHLKRLA     71 - 140
LMIQSSGNTVLLLILCMQHSFPEPGRLYLDLILAILALELICSLICLLIYTVKIRRFNKAKPEPDILEEE    141 - 210
KIYAYPSNITSETGFRTISSLEEIVEKQGDTIEYLKRHNALLSKRLLALTSSDLGCQPSRT             211 - 271
//

Text Mined References (17)

PMID Year Title