Property Summary

NCBI Gene PubMed Count 4
PubMed Score 20.87
PubTator Score 5.83

Knowledge Summary

Patent (8,450)

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma 1.094 2.5e-02
atypical teratoid / rhabdoid tumor -2.600 1.7e-04
glioblastoma -1.300 2.5e-02
medulloblastoma -1.600 3.2e-04
medulloblastoma, large-cell -2.300 5.3e-04
primitive neuroectodermal tumor -1.500 1.7e-03

AA Sequence

MTAVYMNGGGLVNPHYARWDRRDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEKVVREITLGKR      1 - 70
IGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSREISSMEKLHHPNIIRLYEVV     71 - 140
ETLSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVSAVKHMHENQIIHRDLKAENVFYTSNTCV    141 - 210
KVGDFGFSTVSKKGEMLNTFCGSPPYAAPELFRDEHYIGIYVDIWALGVLLYFMVTGTMPFRAETVAKLK    211 - 280
KSILEGTYSVPPHVSEPCHRLIRGVLQQIPTERYGIDCIMNDEWMQGVPYPTPLEPFQLDPKHLSETSTL    281 - 350
KEEENEVKSTLEHLGITEEHIRNNQGRDARSSITGVYRIILHRVQRKKALESVPVMMLPDPKERDLKKGS    351 - 420
RVYRGIRHTSKFCSIL                                                          421 - 436
//

Text Mined References (6)

PMID Year Title