Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.13
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 0.0122189869026295
Multiple Sclerosis 498 0.0431769927976279

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.600 0.012
Multiple Sclerosis 1.300 0.043

Synonym

Accession Q8IY67 A6NMU4 Q8IY60 Q8TF24
Symbols

Gene

PDB

3H2U   3H2V   3SMZ   3VF0  

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (10)

PMID Text
23390309 RAVER1 specifically regulates MDA5 activity, revealing a mechanism of differential regulation of MDA5- and RIG-I-mediated innate antiviral response.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribonucleoprotein PTB-binding 1 protein (RAVER1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22709580 These binding assays show that raver1 forms a ternary complex with metavinculin and vinculin mRNA.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19523901 RAVER1 interactions with vinculin and RNA suggest a feed forward pathway in directing messenger RNA to focal adhesions.
19423540 Observational study of gene-disease association. (HuGE Navigator)
17931803 Raver1 gene promoter region shares common features of ubiquitously expressed gene with the interacting splicing regulator PTB

AA Sequence

MAADVSVTHRPPLSPKSGAEVEAGDAAERRAPEEELPPLDPEEIRKRLEHTERQFRNRRKILIRGLPGDV      1 - 70
TNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQPTDALLCVANLP     71 - 140
PSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDA    141 - 210
GQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEAQQ    211 - 280
QADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNRGKGLLPEPNILQLLNNLGPSASLQLLLNPL    281 - 350
LHGSAGGKQGLLGAPPAMPLLNGPALSTALLQLALQTQGQKKPGILGDSPLGALQPGAQPANPLLGELPA    351 - 420
GGGLPPELPPRRGKPPPLLPSVLGPAGGDREALGLGPPAAQLTPPPAPVGLRGSGLRGPLSHFYSGSPTS    421 - 490
YFTSGLQAGLKQSHLSKAIGSSPLGSGEGLLGLSPGPNGHSHLLKVRAGGGDMQGWEAPAPQRPLTRPAL    491 - 560
PSVSRPHWAARNAALPTCCPRPSPAQKAAMWASTPRASAATTRTPT                            561 - 606
//

Text Mined References (30)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23390309 2013 RAVER1 is a coactivator of MDA5-mediated cellular antiviral response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22709580 2012 The metavinculin tail domain directs constitutive interactions with raver1 and vinculin RNA.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
More...