Property Summary

NCBI Gene PubMed Count 26
PubMed Score 15.22
PubTator Score 12.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -2.000 1.0e-12
breast carcinoma -1.200 3.7e-37
glioblastoma 1.300 7.5e-03
intraductal papillary-mucinous carcinoma... -1.700 8.0e-05
invasive ductal carcinoma -1.500 1.7e-03
lung adenocarcinoma -1.300 1.6e-17
medulloblastoma 1.300 1.3e-03
medulloblastoma, large-cell 1.200 1.4e-04
ovarian cancer -1.600 2.3e-04
pancreatic ductal adenocarcinoma liver m... -1.274 3.0e-02
pituitary cancer -1.900 2.5e-04
primitive neuroectodermal tumor 1.100 3.1e-04

Gene RIF (12)

AA Sequence

MWRAKLRRGTCEPAVKGSPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDP      1 - 70
LCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSS     71 - 140
TENLTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEEAKAQSQFFRGQQQQQQQ    141 - 210
QGAVGHGYYMAGGTSQKSRTEGRPTVNRANSGQAHKDEALKELKQGHVRSLSERIMQLSLERNGAKQHLP    211 - 280
GSGNGKGFKVGGGPSPAQPAGKVLDPRGPPPEYPFKTKQMMSPVSKTQEHGLFYGDQHPGMLHEMVKPYP    281 - 350
APQPVRTDVAVLRYQPPPEYGVTSRPCQLPFPSTMQQHSPMSSQTSSASGPLHSVSLPLPLPMALGAPQP    351 - 420
PPAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQRISEAYESLVKST    421 - 490
TKRESLDKAMRNKLEGEIRRLHDFNRDLRDRLETANRQLSSREYEGHEDKAAEGHYASQNKEFLKEKEKL    491 - 560
EMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEELREKQAYVEKVEKLQQALTQLQSACEKREQME    561 - 630
RRLRTWLERELDALRTQQKHGNGQPANMPEYNAPALLELVREKEERILALEADMTKWEQKYLEESTIRHF    631 - 700
AMNAAATAAAERDTTIINHSRNGSYGESSLEAHIWQEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIK    701 - 770
VLQQRSRKDAGKTDSSSLRPARSVPSIAAATGTHSRQTSLTSSQLAEEKKEEKTWKGSIGLLLGKEHHEH    771 - 840
ASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLSTTPAHSPVLK    841 - 910
HPAAKGTAEKLENSPGHGKSPDHRGRVSSLLHKPEFPDGEMMEVLI                            911 - 956
//

Text Mined References (35)

PMID Year Title