Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.07
PubTator Score 12.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 3.6846119339262E-37
lung adenocarcinoma 2714 1.59058492001335E-17
Breast cancer 3099 1.04506039206815E-12
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.03149053435109E-5
medulloblastoma, large-cell 6234 1.40410360198192E-4
ovarian cancer 8492 2.26017484567908E-4
pituitary cancer 1972 2.52916145262561E-4
primitive neuroectodermal tumor 3031 3.10211387564662E-4
medulloblastoma 1524 0.00133777647529035
invasive ductal carcinoma 2950 0.00169178420914227
glioblastoma 5572 0.00747953122914372
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0301228657600523
Disease Target Count Z-score Confidence
Splenic marginal zone lymphoma 7 3.936 2.0

Expression

  Differential Expression (12)

Synonym

Accession Q8IY63 Q63HK7 Q8NDN0 Q8TEN8 Q8WXD1 Q96CM5
Symbols JEAP

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (11)

PMID Text
26806348 AMOTL1 Promotes Breast Cancer Progression and Is Antagonized by Merlin.
25633977 Knockdown of Angiomotin (AMOT) by siRNA inhibits HIV-1 release and infectivity, but expression of AMOT-like protein 1 and AMOT-like protein 2 can rescue HIV-1 Gag release
25373897 phosphorylation-deficient S793Ala mutant of AMOTL1 showed a shorter half-life and conferred resistance to energy-stress-induced YAP inhibition.
25218344 miR-124 binds AmotL1 3'UTR and down-regulates its expression repressing vasculogenic mimicry and cell motility in cervical cancer cells.
24349473 study defined eight additional recurrently mutated genes in SMZL; these genes are CREBBP, CBFA2T3, AMOTL1, FAT4, FBXO11, PLA2G4D, TRRAP and USH2A.
24003252 Scaffold proteins angiomotin (Amot) and angiomotin-related AmotL1 and AmotL2 were recently identified as negative regulators of YAP and TAZ by preventing their nuclear translocation.
23793505 These results suggested that IFN-gamma exhibits anti-angiogenesis effects by regulating the expression of TNF-alpha-induced AmotL1 via NFkappaB in emphysema lungs.
21685940 AmotL1 and ZO-2 are two candidates that could be harnessed to control the oncogenic function of YAP.
19932912 By yeast two-hybrid screening, angiomotin-like 1 (AmotL1) was identified as a host factor that interacts with the M protein of parainfluenza virus 5 (PIV5).
19590046 Amot and AmotL1 have similar effects on endothelial migration and tight junction formation in vitro. In vivo Amot appears to control the cell polarity and AmotL1 affects the stability of cell-cell junctions.
More...

AA Sequence

MWRAKLRRGTCEPAVKGSPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDP      1 - 70
LCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSS     71 - 140
TENLTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEEAKAQSQFFRGQQQQQQQ    141 - 210
QGAVGHGYYMAGGTSQKSRTEGRPTVNRANSGQAHKDEALKELKQGHVRSLSERIMQLSLERNGAKQHLP    211 - 280
GSGNGKGFKVGGGPSPAQPAGKVLDPRGPPPEYPFKTKQMMSPVSKTQEHGLFYGDQHPGMLHEMVKPYP    281 - 350
APQPVRTDVAVLRYQPPPEYGVTSRPCQLPFPSTMQQHSPMSSQTSSASGPLHSVSLPLPLPMALGAPQP    351 - 420
PPAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQRISEAYESLVKST    421 - 490
TKRESLDKAMRNKLEGEIRRLHDFNRDLRDRLETANRQLSSREYEGHEDKAAEGHYASQNKEFLKEKEKL    491 - 560
EMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEELREKQAYVEKVEKLQQALTQLQSACEKREQME    561 - 630
RRLRTWLERELDALRTQQKHGNGQPANMPEYNAPALLELVREKEERILALEADMTKWEQKYLEESTIRHF    631 - 700
AMNAAATAAAERDTTIINHSRNGSYGESSLEAHIWQEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIK    701 - 770
VLQQRSRKDAGKTDSSSLRPARSVPSIAAATGTHSRQTSLTSSQLAEEKKEEKTWKGSIGLLLGKEHHEH    771 - 840
ASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLSTTPAHSPVLK    841 - 910
HPAAKGTAEKLENSPGHGKSPDHRGRVSSLLHKPEFPDGEMMEVLI                            911 - 956
//

Text Mined References (34)

PMID Year Title
26806348 2016 AMOTL1 Promotes Breast Cancer Progression and Is Antagonized by Merlin.
25373897 2014 Energy stress regulates hippo-YAP signaling involving AMPK-mediated regulation of angiomotin-like 1 protein.
25218344 2014 MiR-124 represses vasculogenic mimicry and cell motility by targeting amotL1 in cervical cancer cells.
24349473 2013 Whole exome sequencing identifies novel recurrently mutated genes in patients with splenic marginal zone lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24003252 2013 Angiomotin'g YAP into the nucleus for cell proliferation and cancer development.
23793505 2013 The role of tumor necrosis factor-? and interferon-? in regulating angiomotin-like protein 1 expression in lung microvascular endothelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22385262 2012 The Nedd4-like ubiquitin E3 ligases target angiomotin/p130 to ubiquitin-dependent degradation.
22362771 2012 The Amotl2 gene inhibits Wnt/?-catenin signaling and regulates embryonic development in zebrafish.
More...