Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $294,944.4
PubMed Score 5.65
PubTator Score 3.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
Pick disease -1.300 0.000

Gene RIF (4)

PMID Text
25603536 These findings uncovered an apoptotic signaling cascade linking YAF2, PDCD5, and TP53 during genotoxic stress responses.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
11953439 YEAF1/RYBP and YAF-2 are functionally distinct members of a cofactor family for the YY1 and E4TF1/hGABP transcription factors.

AA Sequence

MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVP      1 - 70
PTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPAS     71 - 140
SAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH                                  141 - 180
//

Text Mined References (23)

PMID Year Title
25603536 2015 YAF2 promotes TP53-mediated genotoxic stress response via stabilization of PDCD5.
25416956 2014 A proteome-scale map of the human interactome network.
24285299 2014 YY1 DNA binding and interaction with YAF2 is essential for Polycomb recruitment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19960508 2010 PcG recruitment by the YY1 REPO domain can be mediated by Yaf2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...