Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.10
PubTator Score 3.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
Pick disease -1.300 1.1e-04

Gene RIF (4)

AA Sequence

MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVP      1 - 70
PTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPAS     71 - 140
SAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH                                  141 - 180
//

Text Mined References (24)

PMID Year Title