Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.65
PubTator Score 3.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (1)

Disease log2 FC p
Pick disease -1.300 0.000

Synonym

Accession Q8IY57 A8K5P0 B4DFU3 G3V465 Q99710
Symbols

Gene

PDB

2D9G  

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
25603536 These findings uncovered an apoptotic signaling cascade linking YAF2, PDCD5, and TP53 during genotoxic stress responses.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
11953439 YEAF1/RYBP and YAF-2 are functionally distinct members of a cofactor family for the YY1 and E4TF1/hGABP transcription factors.

AA Sequence

MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVP      1 - 70
PTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPAS     71 - 140
SAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH                                  141 - 180
//

Text Mined References (23)

PMID Year Title
25603536 2015 YAF2 promotes TP53-mediated genotoxic stress response via stabilization of PDCD5.
25416956 2014 A proteome-scale map of the human interactome network.
24285299 2014 YY1 DNA binding and interaction with YAF2 is essential for Polycomb recruitment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19960508 2010 PcG recruitment by the YY1 REPO domain can be mediated by Yaf2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...