Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ependymoma 4679 6.0e-11
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Bone marrow cancer 3 0.0 2.7
Disease Target Count Z-score Confidence
Glycogen storage disease V 9 4.787 2.4

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 1.200 6.0e-11

Synonym

Accession Q8IY51 Q96LP5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MAEASVDASTLPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESL      1 - 70
RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQKLGHNDFKCSNGWLDRFKSRY     71 - 140
GLVFRAQPVEATGVPVDPSTVWYQNVLPYYLNDYHPKNVFNIKETGLLYRMLPTNTFAFKGETCSVGKLC    141 - 210
KDRITLVVGTNMDGSEKLPLLVIGKKRTPHCFKGLKSLPVCYEANRMAWMTSDVFEQWMRKLDEEFQAQQ    211 - 280
RRVVIFVESFPAHPEVKNLKSIELAFFPSCLSSKCIAMKQGVIKSLKIKYRHCLIKKFLSSVEGSKEFTF    281 - 350
SLLDAVDTLHLCWRAVTPETIVKSYEEAGFKSQKGESDITNAEKDTGLDLVADALGAGVEFPEGLSIEEY    351 - 420
AALDDDLETCEAAPNGDSICTKESKSDETGFYTSDEEDDDGSPGTELPLPSKSEAITALDTLKKFLRSQD    421 - 490
MNDGLQNSLADLENFINSLSPK                                                    491 - 512
//

Text Mined References (5)

PMID Year Title