Property Summary

NCBI Gene PubMed Count 13
Grant Count 10
R01 Count 8
Funding $727,715.53
PubMed Score 9.47
PubTator Score 3.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (6)

PMID Text
22339580 results of the present study indicate that Golgi localization is indispensable for PAQR10 to implement its regulatory functions in the Ras signalling cascade
21968647 Collectively, this study uncovers a new paradigm of spatial regulation of Ras signaling in the Golgi apparatus by PAQR10 and PAQR11.
20570966 Genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLSDDDWETISAW      1 - 70
IYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLHMFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVW     71 - 140
IMASVGTIYVFFFHERTGSCVQFLRGEACPKAGTACLPARYKLVELLCYVVMGFFPALVILSMPNTEGIW    141 - 210
ELVTGGVFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPSTLQTKVSK              211 - 270
//

Text Mined References (14)

PMID Year Title
22500632 2012 Sox9 and NFIA coordinate a transcriptional regulatory cascade during the initiation of gliogenesis.
22339580 2012 Identification of the topology and functional domains of PAQR10.
21968647 2012 PAQR10 and PAQR11 mediate Ras signaling in the Golgi apparatus.
21226936 2011 Mesenchymal stem cell derived hematopoietic cells are permissive to HIV-1 infection.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18769639 Pancreatic expression and mitochondrial localization of the progestin-adipoQ receptor PAQR10.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
More...