Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.48
PubTator Score 3.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.4e-03
ependymoma -1.400 1.1e-09
osteosarcoma 1.364 1.6e-07
sonic hedgehog group medulloblastoma -1.400 7.5e-04

Synonym

Accession Q8IY49 B5MBW4 Q6NVU5 Q6TCH0
Symbols PAQR10

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLSDDDWETISAW      1 - 70
IYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLHMFDRMVIYFFIAASYAPWLNLRELGPWASHMRWLVW     71 - 140
IMASVGTIYVFFFHERTGSCVQFLRGEACPKAGTACLPARYKLVELLCYVVMGFFPALVILSMPNTEGIW    141 - 210
ELVTGGVFYCLGMVFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPSTLQTKVSK              211 - 270
//

Text Mined References (14)

PMID Year Title