Property Summary

NCBI Gene PubMed Count 3
Grant Count 6
Funding $437,271
PubMed Score 5.00
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.800 0.003
ependymoma -2.400 0.005
oligodendroglioma -1.700 0.009
glioblastoma -2.400 0.000
osteosarcoma -1.144 0.002
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.400 0.001
pediatric high grade glioma -1.900 0.000
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -2.009 0.040
lung carcinoma 1.300 0.000
Pick disease -1.300 0.000

AA Sequence

MPRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRS      1 - 70
CDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNC     71 - 140
QLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDG    141 - 210
AVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY                          211 - 258
//

Text Mined References (5)

PMID Year Title
23761726 2013 Interrogation of the platelet-derived growth factor receptor alpha locus and corneal astigmatism in Australians of Northern European ancestry: results of a genome-wide association study.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.