Property Summary

NCBI Gene PubMed Count 7
Grant Count 12
R01 Count 11
Funding $554,401.83
PubMed Score 20.77
PubTator Score 8.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (1)

PMID Text
21366347 PEPT1,PEPT2, PHT1, and PHT2 are expressed in human nasal epithelium.

AA Sequence

MPAPRAREQPRVPGERQPLLPRGARGPRRWRRAAGAAVLLVEMLERAAFFGVTANLVLYLNSTNFNWTGE      1 - 70
QATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPATAFPDGRSSFCGEMPASPLG     71 - 140
PACPSAGCPRSSPSPYCAPVLYAGLLLLGLAASSVRSNLTSFGADQVMDLGRDATRRFFNWFYWSINLGA    141 - 210
VLSLLVVAFIQQNISFLLGYSIPVGCVGLAFFIFLFATPVFITKPPMGSQVSSMLKLALQNCCPQLWQRH    211 - 280
SARDRQCARVLADERSPQPGASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNIF    281 - 350
PANPANISVALRAQGSSYTIPEAWLLLANVVVVLILVPLKDRLIDPLLLRCKLLPSALQKMALGMFFGFT    351 - 420
SVIVAGVLEMERLHYIHHNETVSQQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRS    421 - 490
MQGAIMGIFFCLSGVGSLLGSSLVALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIA    491 - 560
GRYERASQGPASHSRFSRDRG                                                     561 - 581
//

Text Mined References (9)

PMID Year Title
21366347 2011 Proton-coupled oligopeptide transporter (POT) family expression in human nasal epithelium and their drug transport potential.
17897319 2007 Integral and associated lysosomal membrane proteins.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12905028 2004 The proton oligopeptide cotransporter family SLC15 in physiology and pharmacology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11741232 2000 Human proton/oligopeptide transporter (POT) genes: identification of putative human genes using bioinformatics.
11336635 2001 Cloning of a lymphatic peptide/histidine transporter.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.