Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.23
PubTator Score 4.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 2.5e-06
Atopic dermatitis 1.100 5.5e-04
breast carcinoma 1.100 1.6e-03
esophageal adenocarcinoma 1.400 1.8e-02
fibroadenoma 1.200 2.4e-02
intraductal papillary-mucinous adenoma (... 2.000 2.4e-04
intraductal papillary-mucinous carcinoma... 1.700 1.1e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.4e-03
lung adenocarcinoma 1.800 4.8e-08
malignant mesothelioma 1.400 3.1e-06
medulloblastoma, large-cell -1.900 1.4e-05
ovarian cancer 1.200 6.4e-04
pancreatic cancer 1.100 2.2e-02
progressive supranuclear palsy -1.200 1.3e-02
psoriasis 1.300 3.3e-04

Gene RIF (2)

AA Sequence

MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENNKLAFRVAE      1 - 70
EHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKRASEDSEEEPSGKKAPVQAAK     71 - 140
LPSPAPARKPPLSPAQTNPVVQRRNEGAGGPPPKTDQALAGSLVSSTCGVCGKHVHLVQRHLADGRLYHR    141 - 210
SCFRCKQCSCTLHSGAYKATGEPGTFVCTSHLPAAASASPKLTGLVPRQPGAMGVDSRTSCSPQKAQEAN    211 - 280
KARPSAWEPAAGNSPARASVPAAPNPAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSS    281 - 350
AAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKF    351 - 420
FQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEA    421 - 490
PQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPM    491 - 560
AKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPAERTLKPKEPRALAEPRAGEAPRKVSGSFAG    561 - 630
SVHITLTPVRPDRTPRPASPGPSLPARSPSPPRRRRLAVPASLDVCDNWLRPEPPGQEARVQSWKEEEKK    631 - 700
PHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEG    701 - 770
DDAEDSLMVDWFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEALKSLQERRREQEL    771 - 840
LEQYVSTVNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQRKKSKFRLSKIWSPKSKSSPSQ          841 - 904
//

Text Mined References (18)

PMID Year Title