Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.23
PubTator Score 4.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 4.84268102244771E-8
pilocytic astrocytoma 3086 1.76635092512666E-6
malignant mesothelioma 3163 3.07578998349066E-6
medulloblastoma, large-cell 6234 1.43013062989647E-5
ovarian cancer 8492 7.06032771881508E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.36851075102637E-4
psoriasis 6685 3.28867379007804E-4
Atopic dermatitis 944 5.52953231683299E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00109663730943069
breast carcinoma 1614 0.00161042708826831
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00237423612521908
progressive supranuclear palsy 674 0.0128755145839253
esophageal adenocarcinoma 737 0.0176010007179145
pancreatic cancer 2300 0.021666358165816
fibroadenoma 557 0.023945844717529

Expression

Synonym

Accession Q8IY33 D3YTD2 Q7RTP4 Q7Z655 Q8TEQ4 Q9H5F9
Symbols JRAB
MICAL-L2

Gene

  Ortholog (9)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
25864591 Data indicate that MICAL-L2 may be an important regulator of epithelial-mesenchymal transition (EMT) in ovarian cancer cells.
17891173 Involved in epithelial cell scattering.

AA Sequence

MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENNKLAFRVAE      1 - 70
EHLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKRASEDSEEEPSGKKAPVQAAK     71 - 140
LPSPAPARKPPLSPAQTNPVVQRRNEGAGGPPPKTDQALAGSLVSSTCGVCGKHVHLVQRHLADGRLYHR    141 - 210
SCFRCKQCSCTLHSGAYKATGEPGTFVCTSHLPAAASASPKLTGLVPRQPGAMGVDSRTSCSPQKAQEAN    211 - 280
KARPSAWEPAAGNSPARASVPAAPNPAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSS    281 - 350
AAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKF    351 - 420
FQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEA    421 - 490
PQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPM    491 - 560
AKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPAERTLKPKEPRALAEPRAGEAPRKVSGSFAG    561 - 630
SVHITLTPVRPDRTPRPASPGPSLPARSPSPPRRRRLAVPASLDVCDNWLRPEPPGQEARVQSWKEEEKK    631 - 700
PHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRLRAAEG    701 - 770
DDAEDSLMVDWFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEALKSLQERRREQEL    771 - 840
LEQYVSTVNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQRKKSKFRLSKIWSPKSKSSPSQ          841 - 904
//

Text Mined References (18)

PMID Year Title
25864591 2015 Silencing of MICAL-L2 suppresses malignancy of ovarian cancer by inducing mesenchymal-epithelial transition.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23890175 2013 Junctional Rab13-binding protein (JRAB) regulates cell spreading via filamins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17891173 2008 Involvement of Rab13 and JRAB/MICAL-L2 in epithelial cell scattering.
More...