Property Summary

NCBI Gene PubMed Count 26
Grant Count 21
R01 Count 10
Funding $2,529,658.41
PubMed Score 12.90
PubTator Score 3.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.100 0.036
primary pancreatic ductal adenocarcinoma -1.139 0.009
ovarian cancer 2.400 0.000
pancreatic cancer -1.200 0.004

 GO Function (1)

Gene RIF (3)

PMID Text
26715756 IFT20 is required for the delivery of the intracellular pool of LAT to the immune synapse in naive primary T lymphocytes.
16775004 This work suggests that IFT20 functions in the delivery of ciliary membrane proteins from the Golgi complex to the cilium.
14672413 Data report the molecular cloning and characterization of a novel human cDNA encoding a putative protein of 158 amino acid residues which shares high homology to Mus musculus intraflagellar transport protein mIFT20.

AA Sequence

MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKM      1 - 70
KAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK             71 - 132
//

Text Mined References (27)

PMID Year Title
26715756 2016 IFT20 controls LAT recruitment to the immune synapse and T-cell activation in vivo.
26021297 2015 The small GTPase Rab29 is a common regulator of immune synapse assembly and ciliogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24648492 2014 Casein kinase 1? functions at the centrosome and Golgi to promote ciliogenesis.
23530209 2013 CCDC41 is required for ciliary vesicle docking to the mother centriole.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21490950 2011 The exocyst protein Sec10 interacts with Polycystin-2 and knockdown causes PKD-phenotypes.
21307337 2011 IFT20 is required for opsin trafficking and photoreceptor outer segment development.
More...