Property Summary

NCBI Gene PubMed Count 28
PubMed Score 15.25
PubTator Score 3.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.100 3.6e-02
ovarian cancer -1.600 1.8e-09
pancreatic cancer -1.200 4.4e-03
primary pancreatic ductal adenocarcinoma -1.139 9.3e-03

Gene RIF (4)

AA Sequence

MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKM      1 - 70
KAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK             71 - 132
//

Text Mined References (29)

PMID Year Title