Property Summary

NCBI Gene PubMed Count 10
Grant Count 22
R01 Count 10
Funding $13,467,764.09
PubMed Score 23.23
PubTator Score 13.53

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
23568778 Data indicate that polyisoprenyl diphosphate phosphatase 1 (PDP1) serves an integral signaling role in neutrophil proinflammatory responses and as a target for counter-regulatory mediators.
20110354 PDP1/PPAPDC2 is a functional isoprenoid diphosphate phosphatase.
19220020 PDP1 can serve as a new checkpoint for polyisoprenyl phosphate remodeling during cell activation.[PDP1]
16464866 findings indicate that PPAPDC2 in human PMN is the first lipid phosphate phosphohydrolase identified for PSDP; regulation of this activity of the enzyme may have important roles for PMN activation in innate immunity

AA Sequence

MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATAVDPTCARLRASESPVHRRGS      1 - 70
FPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVCAGESSSWGSVRPLMKLLEIS     71 - 140
GHGIPWLLGTLYCLCRSDSWAGREVLMNLLFALLLDLLLVALIKGLVRRRRPAHNQMDMFVTLSVDKYSF    141 - 210
PSGHATRAALMSRFILNHLVLAIPLRVLVVLWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWL    211 - 280
SPHNAPVLFLLWSQR                                                           281 - 295
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23568778 2013 15-Epi-lipoxin A4 inhibits human neutrophil superoxide anion generation by regulating polyisoprenyl diphosphate phosphatase 1.
21269460 2011 Initial characterization of the human central proteome.
20110354 2010 Functional characterization of the atypical integral membrane lipid phosphatase PDP1/PPAPDC2 identifies a pathway for interconversion of isoprenols and isoprenoid phosphates in mammalian cells.
19220020 2009 Activation of polyisoprenyl diphosphate phosphatase 1 remodels cellular presqualene diphosphate.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16464866 2006 Identification and functional characterization of a presqualene diphosphate phosphatase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...