Property Summary

NCBI Gene PubMed Count 10
PubMed Score 23.23
PubTator Score 13.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 2.9e-03
hepatocellular carcinoma 1.600 2.3e-06
osteosarcoma -1.798 1.0e-06
ovarian cancer 1.200 9.5e-04
pancreatic cancer 1.100 1.9e-03
pancreatic carcinoma 1.100 1.9e-03
pancreatic ductal adenocarcinoma liver m... -2.441 1.1e-03

Gene RIF (4)

AA Sequence

MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATAVDPTCARLRASESPVHRRGS      1 - 70
FPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVCAGESSSWGSVRPLMKLLEIS     71 - 140
GHGIPWLLGTLYCLCRSDSWAGREVLMNLLFALLLDLLLVALIKGLVRRRRPAHNQMDMFVTLSVDKYSF    141 - 210
PSGHATRAALMSRFILNHLVLAIPLRVLVVLWAFVLGLSRVMLGRHNVTDVAFGFFLGYMQYSIVDYCWL    211 - 280
SPHNAPVLFLLWSQR                                                           281 - 295
//

Text Mined References (12)

PMID Year Title