Property Summary

NCBI Gene PubMed Count 27
PubMed Score 35.77
PubTator Score 18.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 1.5e-03
astrocytoma -1.100 4.3e-20
atypical teratoid / rhabdoid tumor -1.100 1.5e-04
glioblastoma -1.100 3.9e-06
group 3 medulloblastoma -1.800 2.9e-03
lung adenocarcinoma 1.100 1.2e-04
lung carcinoma 2.100 5.0e-30
oligodendroglioma -1.100 2.9e-20
osteosarcoma -1.084 1.6e-02
ovarian cancer -1.400 2.4e-05
pituitary cancer -2.100 2.1e-06
posterior fossa group B ependymoma -1.100 2.2e-04

Protein-protein Interaction (4)

Gene RIF (15)

AA Sequence

MDVTSSSGGGGDPRQIEETKPLLGGDVSAPEGTKMGAVPCRRALLLCNGMRYKLLQEGDIQVCVIRHPRT      1 - 70
FLSKILTSKFLRRWEPHHLTLADNSLASATPTGYMENSVSYSAIEDVQLLSWENAPKYCLQLTIPGGTVL     71 - 140
LQAANSYLRDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKL    141 - 210
LSENTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKC    211 - 280
PRLRLFTQEYILALNELNAGMEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYEEFINSRDNSP    281 - 350
SLKEIRNGCQQPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASSEIHVEVERTSTAKPALTASA    351 - 420
GNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEILKLLSDYDDWRPSLASLLQPIPFPKEALAHE    421 - 490
KFTKELKYVIQRFAEDPRQEVHSCLLSVRAGKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKF    491 - 560
LLSLAENKLGPCMLLALRGNQTMVEILCLMLEYNIIDNNDTQLQIISTLESTDVGKRMYEQLCDRQRELK    561 - 630
ELQRKGGPTRLTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGD    631 - 700
AGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYT    701 - 770
EAW                                                                       771 - 773
//

Text Mined References (34)

PMID Year Title