Property Summary

NCBI Gene PubMed Count 25
PubMed Score 29.03
PubTator Score 18.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma multiforme -1.100 0.000
oligodendroglioma -1.100 0.000
osteosarcoma -1.084 0.016
atypical teratoid / rhabdoid tumor -1.100 0.000
adult high grade glioma -1.100 0.001
group 3 medulloblastoma -1.800 0.003
posterior fossa group B ependymoma -1.400 0.000
lung adenocarcinoma 1.100 0.000
lung carcinoma 2.100 0.000
ovarian cancer -1.400 0.000
pituitary cancer -2.100 0.000

Gene RIF (13)

PMID Text
24067439 Results suggest that c-mip and RelA define two distinct types of renal damage associated with VEGF-targeted therapies.
23302718 c-mip has an active role in the podocyte disorders of membranous nephropathy.
22507836 These results suggest that alterations in NF-kappaB activity might result from the up-regulation of c-mip and are likely to contribute to podocyte disorders in cases of idiopathic nephrotic syndrome.
21493956 Eight suggestive significant loci were detected with a series of genes expressed within the inner ear that underlie the auditory function, such as: DCLK1, PTPRD, GRM8, CMIP.
21457949 we provide novel evidence that the language-disorder candidate gene CMIP is implicated in reading processes.
20484117 results identify c-mip as a key component in the molecular pathogenesis of acquired podocyte diseases
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200355 Induction of c-mip in Hodgkin-Reed Sternberg cells and podocytes is associated with minimal change nephrotic syndrome in classical Hodgkin lymphoma.
20018188 Data demonstrate that c-mip interacts with Dip1 and upregulates DAPK, which blocks the nuclear translocation of ERK1/2.
19646677 CMIP modulates phonological short-term memory in language impairment.
More...

AA Sequence

MDVTSSSGGGGDPRQIEETKPLLGGDVSAPEGTKMGAVPCRRALLLCNGMRYKLLQEGDIQVCVIRHPRT      1 - 70
FLSKILTSKFLRRWEPHHLTLADNSLASATPTGYMENSVSYSAIEDVQLLSWENAPKYCLQLTIPGGTVL     71 - 140
LQAANSYLRDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKL    141 - 210
LSENTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKC    211 - 280
PRLRLFTQEYILALNELNAGMEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYEEFINSRDNSP    281 - 350
SLKEIRNGCQQPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASSEIHVEVERTSTAKPALTASA    351 - 420
GNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEILKLLSDYDDWRPSLASLLQPIPFPKEALAHE    421 - 490
KFTKELKYVIQRFAEDPRQEVHSCLLSVRAGKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKF    491 - 560
LLSLAENKLGPCMLLALRGNQTMVEILCLMLEYNIIDNNDTQLQIISTLESTDVGKRMYEQLCDRQRELK    561 - 630
ELQRKGGPTRLTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGD    631 - 700
AGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYT    701 - 770
EAW                                                                       771 - 773
//

Text Mined References (32)

PMID Year Title
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24067439 2014 Expression patterns of RelA and c-mip are associated with different glomerular diseases following anti-VEGF therapy.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23302718 2013 Upregulation of c-mip is closely related to podocyte dysfunction in membranous nephropathy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22507836 2012 c-mip down-regulates NF-?B activity and promotes apoptosis in podocytes.
More...