Property Summary

NCBI Gene PubMed Count 25
PubMed Score 29.03
PubTator Score 18.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 5.00363886329506E-30
oligodendroglioma 2849 2.93249343741035E-20
astrocytoma 1493 4.30518074036799E-20
glioblastoma multiforme 347 3.21596245441574E-19
posterior fossa group B ependymoma 1530 4.18758258277079E-9
pituitary cancer 1972 2.075873360136E-6
ovarian cancer 8492 2.41693931039964E-5
lung adenocarcinoma 2714 1.22500809099494E-4
atypical teratoid / rhabdoid tumor 4369 1.5482100955948E-4
adult high grade glioma 2148 0.00146949602181639
group 3 medulloblastoma 2254 0.00291151145224708
osteosarcoma 7933 0.0156992180838661

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma multiforme -1.100 0.000
oligodendroglioma -1.100 0.000
osteosarcoma -1.084 0.016
atypical teratoid / rhabdoid tumor -1.100 0.000
adult high grade glioma -1.100 0.001
group 3 medulloblastoma -1.800 0.003
posterior fossa group B ependymoma -1.400 0.000
lung adenocarcinoma 1.100 0.000
lung carcinoma 2.100 0.000
ovarian cancer -1.400 0.000
pituitary cancer -2.100 0.000

Synonym

Accession Q8IY22 Q9C0G9 c-Mip
Symbols TCMIP

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Pathway (1)

Gene RIF (13)

PMID Text
24067439 Results suggest that c-mip and RelA define two distinct types of renal damage associated with VEGF-targeted therapies.
23302718 c-mip has an active role in the podocyte disorders of membranous nephropathy.
22507836 These results suggest that alterations in NF-kappaB activity might result from the up-regulation of c-mip and are likely to contribute to podocyte disorders in cases of idiopathic nephrotic syndrome.
21493956 Eight suggestive significant loci were detected with a series of genes expressed within the inner ear that underlie the auditory function, such as: DCLK1, PTPRD, GRM8, CMIP.
21457949 we provide novel evidence that the language-disorder candidate gene CMIP is implicated in reading processes.
20484117 results identify c-mip as a key component in the molecular pathogenesis of acquired podocyte diseases
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200355 Induction of c-mip in Hodgkin-Reed Sternberg cells and podocytes is associated with minimal change nephrotic syndrome in classical Hodgkin lymphoma.
20018188 Data demonstrate that c-mip interacts with Dip1 and upregulates DAPK, which blocks the nuclear translocation of ERK1/2.
19646677 CMIP modulates phonological short-term memory in language impairment.
More...

AA Sequence

MDVTSSSGGGGDPRQIEETKPLLGGDVSAPEGTKMGAVPCRRALLLCNGMRYKLLQEGDIQVCVIRHPRT      1 - 70
FLSKILTSKFLRRWEPHHLTLADNSLASATPTGYMENSVSYSAIEDVQLLSWENAPKYCLQLTIPGGTVL     71 - 140
LQAANSYLRDQWFHSLQWKKKIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKL    141 - 210
LSENTNLTTQEHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKC    211 - 280
PRLRLFTQEYILALNELNAGMEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYEEFINSRDNSP    281 - 350
SLKEIRNGCQQPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASSEIHVEVERTSTAKPALTASA    351 - 420
GNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEILKLLSDYDDWRPSLASLLQPIPFPKEALAHE    421 - 490
KFTKELKYVIQRFAEDPRQEVHSCLLSVRAGKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKF    491 - 560
LLSLAENKLGPCMLLALRGNQTMVEILCLMLEYNIIDNNDTQLQIISTLESTDVGKRMYEQLCDRQRELK    561 - 630
ELQRKGGPTRLTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGD    631 - 700
AGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYT    701 - 770
EAW                                                                       771 - 773
//

Text Mined References (32)

PMID Year Title
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24067439 2014 Expression patterns of RelA and c-mip are associated with different glomerular diseases following anti-VEGF therapy.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23302718 2013 Upregulation of c-mip is closely related to podocyte dysfunction in membranous nephropathy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22507836 2012 c-mip down-regulates NF-?B activity and promotes apoptosis in podocytes.
More...