Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.06
PubTator Score 2.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.309 6.5e-03
acute myeloid leukemia -1.800 3.4e-02
adult high grade glioma 1.800 5.1e-05
Astrocytoma, Pilocytic 2.000 1.2e-07
atypical teratoid / rhabdoid tumor 1.400 1.4e-03
Barrett's esophagus 1.500 4.4e-02
colon cancer -1.700 1.5e-02
cutaneous lupus erythematosus 1.800 6.5e-05
cystic fibrosis 1.928 2.9e-06
dermatomyositis 1.400 2.6e-02
ependymoma 2.200 8.5e-11
esophageal adenocarcinoma 1.300 2.8e-02
glioblastoma 2.000 1.9e-08
intraductal papillary-mucinous adenoma (... 1.500 3.0e-02
intraductal papillary-mucinous neoplasm ... 3.500 2.6e-03
juvenile dermatomyositis 2.265 2.8e-18
lung cancer -1.600 2.7e-03
lung carcinoma -1.600 2.0e-19
Multiple Sclerosis 2.200 2.8e-03
nasopharyngeal carcinoma 1.200 3.6e-03
ovarian cancer -1.400 9.2e-03
pancreatic cancer 1.500 1.1e-04
primary Sjogren syndrome 2.800 2.4e-08
psoriasis 1.100 5.8e-04
sarcoidosis 1.300 2.0e-02
sonic hedgehog group medulloblastoma 1.400 3.6e-03
Systemic lupus erythematosus 1.500 1.7e-04

Gene RIF (3)

AA Sequence

MERNVLTTFSQEMSQLILNEMPKAEYSSLFNDFVESEFFLIDGDSLLITCICEISFKPGQNLHFFYLVER      1 - 70
YLVDLISKGGQFTIVFFKDAEYAYFNFPELLSLRTALILHLQKNTTIDVRTTFSRCLSKEWGSFLEESYP     71 - 140
YFLIVADEGLNDLQTQLFNFLIIHSWARKVNVVLSSGQESDVLCLYAYLLPSMYRHQIFSWKNKQNIKDA    141 - 210
YTTLLNQLERFKLSALAPLFGSLKWNNITEEAHKTVSLLTQVWPEGSDIRRVFCVTSCSLSLRMYHRFLG    211 - 280
NREPSSGQETEIQQVNSNCLTLQEMEDLCKLHCLTVVFLLHLPLSQRACARVITSHWAEDMKPLLQMKKW    281 - 350
CEYFILRNIHTFEFWNLNLIHLSDLNDELLLKNIAFYYENENVKGLHLNLGDTIMKDYEYLWNTVSKLVR    351 - 420
DFEVGQPFPLRTTKVCFLEKKPSPIKDSSNEMVPNLGFIPTSSFVVDKFAGDILKDLPFLKSDDPIVTSL    421 - 490
VKQKEFDELVHWHSHKPLSDDYDRSRCQFDEKSRDPRVLRSVQKYHVFQRFYGNSLETVSSKIIVTQTIK    491 - 560
SKKDFSGPKSKKAHETKAEIIARENKKRLFAREEQKEEQKWNALSFSIEEQLKENLHSGIKSLEDFLKSC    561 - 630
KSSCVKLQVEMVGLTACLKAWKEHCRSEEGKTTKDLSIAVQVMKRIHSLMEKYSELLQEDDRQLIARCLK    631 - 700
YLGFDELASSLHPAQDAENDVKVKKRNKYSVGIGPARFQLQYMGHYLIRDERKDPDPRVQDFIPDTWQRE    701 - 770
LLDVVDKNESAVIVAPTSSGKTYASYYCMEKVLKESDDGVVVYVAPTKALVNQVAATVQNRFTKNLPSGE    771 - 840
VLCGVFTREYRHDALNCQVLITVPACFEILLLAPHRQNWVKKIRYVIFDEVHCLGGEIGAEIWEHLLVMI    841 - 910
RCPFLALSATISNPEHLTEWLQSVKWYWKQEDKIIENNTASKRHVGRQAGFPKDYLQVKQSYKVRLVLYG    911 - 980
ERYNDLEKHVCSIKHGDIHFDHFHPCAALTTDHIERYGFPPDLTLSPRESIQLYDAMFQIWKSWPRAQEL    981 - 1050
CPENFIHFNNKLVIKKMDARKYEESLKAELTSWIKNGNVEQARMVLQNLSPEADLSPENMITMFPLLVEK   1051 - 1120
LRKMEKLPALFFLFKLGAVENAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKS   1121 - 1190
QKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKGEELKALAERG   1191 - 1260
IGYHHSAMSFKEKQLVEILFRKGYLRVVTATGTLALGVNMPCKSVVFAQNSVYLDALNYRQMSGRAGRRG   1261 - 1330
QDLMGDVYFFDIPFPKIGKLIKSNVPELRGHFPLSITLVLRLMLLASKGDDPEDAKAKVLSVLKHSLLSF   1331 - 1400
KQPRVMDMLKLYFLFSLQFLVKEGYLDQEGNPMGFAGLVSHLHYHEPSNLVFVSFLVNGLFHDLCQPTRK   1401 - 1470
GSKHFSQDVMEKLVLVLAHLFGRRYFPPKFQDAHFEFYQSKVFLDDLPEDFSDALDEYNMKIMEDFTTFL   1471 - 1540
RIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVT   1541 - 1610
LGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSIS   1611 - 1680
VSLRELCENEDDNVVLAFEQLSTTFWEKLNKV                                         1681 - 1712
//

Text Mined References (8)

PMID Year Title