Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.99
PubTator Score 2.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Influenza 142
Disease Target Count P-value
psoriasis 6685 1.565428430683E-55
lung carcinoma 2844 1.98243918512248E-19
juvenile dermatomyositis 1189 2.80687725889054E-18
posterior fossa group A ependymoma 1511 3.17220721982004E-11
glioblastoma 5572 1.91998656560722E-8
primary Sjogren syndrome 789 2.41134854900646E-8
pilocytic astrocytoma 3086 6.47383252836507E-8
pediatric high grade glioma 2712 4.09002156486153E-7
cystic fibrosis 1670 2.89466354367619E-6
atypical teratoid/rhabdoid tumor 1095 5.83336329834613E-6
lung cancer 4473 4.16387659407756E-5
cutaneous lupus erythematosus 1056 6.48322636943759E-5
pancreatic cancer 2300 1.09942618013188E-4
systemic lupus erythematosus 172 1.65982689274584E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00255809052114434
Multiple Sclerosis 498 0.00277063646736877
nasopharyngeal carcinoma 1056 0.00358123505159068
sonic hedgehog group medulloblastoma 1482 0.00359393794407692
active Crohn's disease 918 0.00649817688010845
ovarian cancer 8492 0.00915909751589368
colon cancer 1475 0.015452069865835
sarcoidosis 368 0.0195748437776942
dermatomyositis 967 0.0255419046637018
esophageal adenocarcinoma 737 0.0275942381663878
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0300542976482006
acute myeloid leukemia 785 0.0344877625427646
Barrett's esophagus 185 0.0441005050657487
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q8IY21 Q6PK35 Q9NVE3
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG

Pathway (1)

Gene RIF (3)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of DDX60 in human monocyte-derived dendritic cells
25981042 Results define DDX60 as a sentinel for cytoplasmic antiviral response, which is counteracted by virus-mediated EGF receptor activation.
21791617 DDX60 is a novel antiviral helicase promoting RIG-I-like receptor-mediated signaling.

AA Sequence

MERNVLTTFSQEMSQLILNEMPKAEYSSLFNDFVESEFFLIDGDSLLITCICEISFKPGQNLHFFYLVER      1 - 70
YLVDLISKGGQFTIVFFKDAEYAYFNFPELLSLRTALILHLQKNTTIDVRTTFSRCLSKEWGSFLEESYP     71 - 140
YFLIVADEGLNDLQTQLFNFLIIHSWARKVNVVLSSGQESDVLCLYAYLLPSMYRHQIFSWKNKQNIKDA    141 - 210
YTTLLNQLERFKLSALAPLFGSLKWNNITEEAHKTVSLLTQVWPEGSDIRRVFCVTSCSLSLRMYHRFLG    211 - 280
NREPSSGQETEIQQVNSNCLTLQEMEDLCKLHCLTVVFLLHLPLSQRACARVITSHWAEDMKPLLQMKKW    281 - 350
CEYFILRNIHTFEFWNLNLIHLSDLNDELLLKNIAFYYENENVKGLHLNLGDTIMKDYEYLWNTVSKLVR    351 - 420
DFEVGQPFPLRTTKVCFLEKKPSPIKDSSNEMVPNLGFIPTSSFVVDKFAGDILKDLPFLKSDDPIVTSL    421 - 490
VKQKEFDELVHWHSHKPLSDDYDRSRCQFDEKSRDPRVLRSVQKYHVFQRFYGNSLETVSSKIIVTQTIK    491 - 560
SKKDFSGPKSKKAHETKAEIIARENKKRLFAREEQKEEQKWNALSFSIEEQLKENLHSGIKSLEDFLKSC    561 - 630
KSSCVKLQVEMVGLTACLKAWKEHCRSEEGKTTKDLSIAVQVMKRIHSLMEKYSELLQEDDRQLIARCLK    631 - 700
YLGFDELASSLHPAQDAENDVKVKKRNKYSVGIGPARFQLQYMGHYLIRDERKDPDPRVQDFIPDTWQRE    701 - 770
LLDVVDKNESAVIVAPTSSGKTYASYYCMEKVLKESDDGVVVYVAPTKALVNQVAATVQNRFTKNLPSGE    771 - 840
VLCGVFTREYRHDALNCQVLITVPACFEILLLAPHRQNWVKKIRYVIFDEVHCLGGEIGAEIWEHLLVMI    841 - 910
RCPFLALSATISNPEHLTEWLQSVKWYWKQEDKIIENNTASKRHVGRQAGFPKDYLQVKQSYKVRLVLYG    911 - 980
ERYNDLEKHVCSIKHGDIHFDHFHPCAALTTDHIERYGFPPDLTLSPRESIQLYDAMFQIWKSWPRAQEL    981 - 1050
CPENFIHFNNKLVIKKMDARKYEESLKAELTSWIKNGNVEQARMVLQNLSPEADLSPENMITMFPLLVEK   1051 - 1120
LRKMEKLPALFFLFKLGAVENAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKS   1121 - 1190
QKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKGEELKALAERG   1191 - 1260
IGYHHSAMSFKEKQLVEILFRKGYLRVVTATGTLALGVNMPCKSVVFAQNSVYLDALNYRQMSGRAGRRG   1261 - 1330
QDLMGDVYFFDIPFPKIGKLIKSNVPELRGHFPLSITLVLRLMLLASKGDDPEDAKAKVLSVLKHSLLSF   1331 - 1400
KQPRVMDMLKLYFLFSLQFLVKEGYLDQEGNPMGFAGLVSHLHYHEPSNLVFVSFLVNGLFHDLCQPTRK   1401 - 1470
GSKHFSQDVMEKLVLVLAHLFGRRYFPPKFQDAHFEFYQSKVFLDDLPEDFSDALDEYNMKIMEDFTTFL   1471 - 1540
RIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVT   1541 - 1610
LGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSIS   1611 - 1680
VSLRELCENEDDNVVLAFEQLSTTFWEKLNKV                                         1681 - 1712
//

Text Mined References (8)

PMID Year Title
25981042 2015 DDX60 Is Involved in RIG-I-Dependent and Independent Antiviral Responses, and Its Function Is Attenuated by Virus-Induced EGFR Activation.
21791617 2011 DDX60, a DEXD/H box helicase, is a novel antiviral factor promoting RIG-I-like receptor-mediated signaling.
21478870 2011 A diverse range of gene products are effectors of the type I interferon antiviral response.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.