Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.06
PubTator Score 0.89

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6


Gene RIF (2)

AA Sequence

SFISLQSSPSPGAQPRVRAPRAPLTKDSGKPLHIKPRL                                    911 - 948

Text Mined References (14)

PMID Year Title